Property Summary

Ligand Count 14
NCBI Gene PubMed Count 9
PubMed Score 30.61
PubTator Score 2.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
aldosterone-producing adenoma -1.580 6.7e-03
Astrocytoma, Pilocytic 1.200 3.5e-02
atypical teratoid / rhabdoid tumor -1.600 1.3e-02
ductal carcinoma in situ -2.500 1.4e-03
interstitial cystitis -1.400 4.9e-03
invasive ductal carcinoma -2.800 5.3e-03
lung cancer -1.400 4.7e-04
malignant mesothelioma 2.300 1.2e-07
medulloblastoma -1.300 4.9e-02
medulloblastoma, large-cell -1.100 6.2e-03
osteosarcoma -1.586 3.5e-02
ovarian cancer -1.100 4.3e-07
pituitary cancer -1.100 2.8e-02
posterior fossa group B ependymoma 1.100 4.0e-02
psoriasis -1.500 3.6e-03

Gene RIF (3)

AA Sequence

MAESRGRLYLWMCLAAALASFLMGFMVGWFIKPLKETTTSVRYHQSIRWKLVSEMKAENIKSFLRSFTKL      1 - 70
PHLAGTEQNFLLAKKIQTQWKKFGLDSAKLVHYDVLLSYPNETNANYISIVDEHETEIFKTSYLEPPPDG     71 - 140
YENVTNIVPPYNAFSAQGMPEGDLVYVNYARTEDFFKLEREMGINCTGKIVIARYGKIFRGNKVKNAMLA    141 - 210
GAIGIILYSDPADYFAPEVQPYPKGWNLPGTAAQRGNVLNLNGAGDPLTPGYPAKEYTFRLDVEEGVGIP    211 - 280
RIPVHPIGYNDAEILLRYLGGIAPPDKSWKGALNVSYSIGPGFTGSDSFRKVRMHVYNINKITRIYNVVG    281 - 350
TIRGSVEPDRYVILGGHRDSWVFGAIDPTSGVAVLQEIARSFGKLMSKGWRPRRTIIFASWDAEEFGLLG    351 - 420
STEWAEENVKILQERSIAYINSDSSIEGNYTLRVDCTPLLYQLVYKLTKEIPSPDDGFESKSLYESWLEK    421 - 490
DPSPENKNLPRINKLGSGSDFEAYFQRLGIASGRARYTKNKKTDKYSSYPVYHTIYETFELVEKFYDPTF    491 - 560
KKQLSVAQLRGALVYELVDSKIIPFNIQDYAEALKNYAASIYNLSKKHDQQLTDHGVSFDSLFSAVKNFS    561 - 630
EAASDFHKRLIQVDLNNPIAVRMMNDQLMLLERAFIDPLGLPGKLFYRHIIFAPSSHNKYAGESFPGIYD    631 - 700
AIFDIENKANSRLAWKEVKKHISIAAFTIQAAAGTLKEVL                                  701 - 740
//

Text Mined References (11)

PMID Year Title