Property Summary

NCBI Gene PubMed Count 9
Grant Count 14
R01 Count 5
Funding $1,211,002.03
PubMed Score 30.41
PubTator Score 2.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 2.300 0.000
psoriasis -1.500 0.004
osteosarcoma -1.586 0.035
atypical teratoid / rhabdoid tumor -1.600 0.013
medulloblastoma -1.300 0.049
medulloblastoma, large-cell -1.600 0.009
lung cancer -1.400 0.000
interstitial cystitis -1.400 0.005
pilocytic astrocytoma 1.200 0.033
posterior fossa group B ependymoma 1.100 0.040
aldosterone-producing adenoma -1.580 0.007
ductal carcinoma in situ -2.500 0.001
invasive ductal carcinoma -2.800 0.005
ovarian cancer -1.100 0.000
pituitary cancer -1.100 0.028

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12204797 GCPII polymorphism may affect the predisposition to cardiovascular diseases.
11905994 four novel compounds, Ac-Glu-Met, Ac-Asp-Met and, surprisingly, Ac-Ala-Glu and Ac-Ala-Met were identified as substrates for GCPII

AA Sequence

MAESRGRLYLWMCLAAALASFLMGFMVGWFIKPLKETTTSVRYHQSIRWKLVSEMKAENIKSFLRSFTKL      1 - 70
PHLAGTEQNFLLAKKIQTQWKKFGLDSAKLVHYDVLLSYPNETNANYISIVDEHETEIFKTSYLEPPPDG     71 - 140
YENVTNIVPPYNAFSAQGMPEGDLVYVNYARTEDFFKLEREMGINCTGKIVIARYGKIFRGNKVKNAMLA    141 - 210
GAIGIILYSDPADYFAPEVQPYPKGWNLPGTAAQRGNVLNLNGAGDPLTPGYPAKEYTFRLDVEEGVGIP    211 - 280
RIPVHPIGYNDAEILLRYLGGIAPPDKSWKGALNVSYSIGPGFTGSDSFRKVRMHVYNINKITRIYNVVG    281 - 350
TIRGSVEPDRYVILGGHRDSWVFGAIDPTSGVAVLQEIARSFGKLMSKGWRPRRTIIFASWDAEEFGLLG    351 - 420
STEWAEENVKILQERSIAYINSDSSIEGNYTLRVDCTPLLYQLVYKLTKEIPSPDDGFESKSLYESWLEK    421 - 490
DPSPENKNLPRINKLGSGSDFEAYFQRLGIASGRARYTKNKKTDKYSSYPVYHTIYETFELVEKFYDPTF    491 - 560
KKQLSVAQLRGALVYELVDSKIIPFNIQDYAEALKNYAASIYNLSKKHDQQLTDHGVSFDSLFSAVKNFS    561 - 630
EAASDFHKRLIQVDLNNPIAVRMMNDQLMLLERAFIDPLGLPGKLFYRHIIFAPSSHNKYAGESFPGIYD    631 - 700
AIFDIENKANSRLAWKEVKKHISIAAFTIQAAAGTLKEVL                                  701 - 740
//

Text Mined References (11)

PMID Year Title
21738478 2011 Identification of nine novel loci associated with white blood cell subtypes in a Japanese population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19678840 2009 Structural insight into the evolutionary and pharmacologic homology of glutamate carboxypeptidases II and III.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12204797 2002 Influence of a glutamate carboxypeptidase II (GCPII) polymorphism (1561C-->T) on plasma homocysteine, folate and vitamin B(12) levels and its relationship to cardiovascular disease risk.
11352574 2001 Identification of genes from a schizophrenia-linked translocation breakpoint region.
More...