Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.69
PubTator Score 3.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
dermatomyositis 1.100 2.6e-03
ependymoma 1.200 6.0e-03
intraductal papillary-mucinous neoplasm ... 1.100 1.5e-02
medulloblastoma, large-cell -1.100 2.5e-03
Multiple myeloma 1.293 1.5e-03
osteosarcoma 1.550 1.3e-04
ovarian cancer -2.100 1.7e-07
pancreatic ductal adenocarcinoma liver m... 1.590 3.9e-03
psoriasis -1.200 1.4e-03

Gene RIF (2)

AA Sequence

MDDKASVGKISVSSDSVSTLNSEDFVLVSRQGDETPSTNNGSDDEKTGLKIVGNGSEQQLQKELADVLMD      1 - 70
PPMDDQPGEKELVKRSQLDGEGDGPLSNQLSASSTINPVPLVGLQKPEMSLPVKPGQGDSEASSPFTPVA     71 - 140
DEDSVVFSKLTYLGCASVNAPRSEVEALRMMSILRSQCQISLDVTLSVPNVSEGIVRLLDPQTNTEIANY    141 - 210
PIYKILFCVRGHDGTPESDCFAFTESHYNAELFRIHVFRCEIQEAVSRILYSFATAFRRSAKQTPLSATA    211 - 280
APQTPDSDIFTFSVSLEIKEDDGKGYFSAVPKDKDRQCFKLRQGIDKKIVIYVQQTTNKELAIERCFGLL    281 - 350
LSPGKDVRNSDMHLLDLESMGKSSDGKSYVITGSWNPKSPHFQVVNEETPKDKVLFMTTAVDLVITEVQE    351 - 420
PVRFLLETKVRVCSPNERLFWPFSKRSTTENFFLKLKQIKQRERKNNTDTLYEVVCLESESERERRKTTA    421 - 490
SPSVRLPQSGSQSSVIPSPPEDDEEEDNDEPLLSGSGDVSKECAEKILETWGELLSKWHLNLNVRPKQLS    491 - 560
SLVRNGVPEALRGEVWQLLAGCHNNDHLVEKYRILITKESPQDSAITRDINRTFPAHDYFKDTGGDGQDS    561 - 630
LYKICKAYSVYDEEIGYCQGQSFLAAVLLLHMPEEQAFSVLVKIMFDYGLRELFKQNFEDLHCKFYQLER    631 - 700
LMQEYIPDLYNHFLDISLEAHMYASQWFLTLFTAKFPLYMVFHIIDLLLCEGISVIFNVALGLLKTSKDD    701 - 770
LLLTDFEGALKFFRVQLPKRYRSEENAKKLMELACNMKISQKKLKKYEKEYHTMREQQAQQEDPIERFER    771 - 840
ENRRLQEANMRLEQENDDLAHELVTSKIALRKDLDNAEEKADALNKELLMTKQKLIDAEEEKRRLEEESA    841 - 910
QLKEMCRRELDKAESEIKKNSSIIGDYKQICSQLSERLEKQQTANKVEIEKIRQKVDDCERCREFFNKEG    911 - 980
RVKGISSTKEVLDEDTDEEKETLKNQLREMELELAQTKLQLVEAECKIQDLEHHLGLALNEVQAAKKTWF    981 - 1050
NRTLSSIKTATGVQGKETC                                                      1051 - 1069
//

Text Mined References (19)

PMID Year Title