Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.42
PubTator Score 3.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.293 0.002
ependymoma 1.200 0.006
psoriasis -1.200 0.001
osteosarcoma 1.550 0.000
medulloblastoma, large-cell -1.100 0.003
pancreatic ductal adenocarcinoma liver m... 1.590 0.004
intraductal papillary-mucinous neoplasm ... 1.100 0.015
ovarian cancer 2.300 0.000
dermatomyositis 1.100 0.003

Synonym

Accession Q9Y3P9 B9A6L2 Q05CW2 Q6ZMY1 Q9HA28 Q9P0E2 Q9UG67
Symbols GAPCENA
TBC1D11

Gene

PANTHER Protein Class (2)

PDB

4NC6  

Gene RIF (2)

PMID Text
23248241 suggest that EPI64A and B, which are ubiquitously expressed members of the EPI64 subfamily, inactivate Ras and certain Rabs at the periphery of cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MDDKASVGKISVSSDSVSTLNSEDFVLVSRQGDETPSTNNGSDDEKTGLKIVGNGSEQQLQKELADVLMD      1 - 70
PPMDDQPGEKELVKRSQLDGEGDGPLSNQLSASSTINPVPLVGLQKPEMSLPVKPGQGDSEASSPFTPVA     71 - 140
DEDSVVFSKLTYLGCASVNAPRSEVEALRMMSILRSQCQISLDVTLSVPNVSEGIVRLLDPQTNTEIANY    141 - 210
PIYKILFCVRGHDGTPESDCFAFTESHYNAELFRIHVFRCEIQEAVSRILYSFATAFRRSAKQTPLSATA    211 - 280
APQTPDSDIFTFSVSLEIKEDDGKGYFSAVPKDKDRQCFKLRQGIDKKIVIYVQQTTNKELAIERCFGLL    281 - 350
LSPGKDVRNSDMHLLDLESMGKSSDGKSYVITGSWNPKSPHFQVVNEETPKDKVLFMTTAVDLVITEVQE    351 - 420
PVRFLLETKVRVCSPNERLFWPFSKRSTTENFFLKLKQIKQRERKNNTDTLYEVVCLESESERERRKTTA    421 - 490
SPSVRLPQSGSQSSVIPSPPEDDEEEDNDEPLLSGSGDVSKECAEKILETWGELLSKWHLNLNVRPKQLS    491 - 560
SLVRNGVPEALRGEVWQLLAGCHNNDHLVEKYRILITKESPQDSAITRDINRTFPAHDYFKDTGGDGQDS    561 - 630
LYKICKAYSVYDEEIGYCQGQSFLAAVLLLHMPEEQAFSVLVKIMFDYGLRELFKQNFEDLHCKFYQLER    631 - 700
LMQEYIPDLYNHFLDISLEAHMYASQWFLTLFTAKFPLYMVFHIIDLLLCEGISVIFNVALGLLKTSKDD    701 - 770
LLLTDFEGALKFFRVQLPKRYRSEENAKKLMELACNMKISQKKLKKYEKEYHTMREQQAQQEDPIERFER    771 - 840
ENRRLQEANMRLEQENDDLAHELVTSKIALRKDLDNAEEKADALNKELLMTKQKLIDAEEEKRRLEEESA    841 - 910
QLKEMCRRELDKAESEIKKNSSIIGDYKQICSQLSERLEKQQTANKVEIEKIRQKVDDCERCREFFNKEG    911 - 980
RVKGISSTKEVLDEDTDEEKETLKNQLREMELELAQTKLQLVEAECKIQDLEHHLGLALNEVQAAKKTWF    981 - 1050
NRTLSSIKTATGVQGKETC                                                      1051 - 1069
//

Text Mined References (19)

PMID Year Title
23248241 2013 All members of the EPI64 subfamily of TBC/RabGAPs also have GAP activities towards Ras.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22354992 2012 Rab GTPase-activating proteins in autophagy: regulation of endocytic and autophagy pathways by direct binding to human ATG8 modifiers.
21269460 2011 Initial characterization of the human central proteome.
20562859 2010 Network organization of the human autophagy system.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19077034 2009 Identification and characterization of a novel Tre-2/Bub2/Cdc16 (TBC) protein that possesses Rab3A-GAP activity.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17646400 2007 Functional dissection of Rab GTPases involved in primary cilium formation.
More...