Property Summary

NCBI Gene PubMed Count 11
Grant Count 2
Funding $418,000
PubMed Score 49.85
PubTator Score 25.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
lung cancer 1.400 0.004

Gene RIF (4)

PMID Text
21555518 RHBDD3 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
19212622 the EWSR1 promoter functions in a bidirectional manner, thereby regulating also RHBDD3
17117413 Loss of PTAG contributes to a blunted apoptotic response and is likely to predispose cells toward malignant transformation and resistance to chemotherapeutic interventions.
15105437 isolation of a novel differentially methylated chromosome 22 CpG island-associated gene PTAG

AA Sequence

MHARGPHGQLSPALPLASSVLMLLMSTLWLVGAGPGLVLAPELLLDPWQVHRLLTHALGHTALPGLLLSL      1 - 70
LLLPTVGWQQECHLGTLRFLHASALLALASGLLAVLLAGLGLSSAAGSCGYMPVHLAMLAGEGHRPRRPR     71 - 140
GALPPWLSPWLLLALTPLLSSEPPFLQLLCGLLAGLAYAAGAFRWLEPSERRLQVLQEGVLCRTLAGCWP    141 - 210
LRLLATPGSLAELPVTHPAGVRPPIPGPPYVASPDLWSHWEDSALPPPSLRPVQPTWEGSSEAGLDWAGA    211 - 280
SFSPGTPMWAALDEQMLQEGIQASLLDGPAQEPQSAPWLSKSSVSSLRLQQLERMGFPTEQAVVALAATG    281 - 350
RVEGAVSLLVGGQVGTETLVTHGKGGPAHSEGPGPP                                      351 - 386
//

Text Mined References (11)

PMID Year Title
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
19212622 2009 Bidirectionality and transcriptional activity of the EWSR1 promoter region.
17117413 2007 Primary colorectal tumors fail to express the proapoptotic mediator PTAG and its reexpression augments drug-induced apoptosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15105437 2004 Isolation and characterization of a novel pituitary tumor apoptosis gene.
12529303 2003 Reevaluating human gene annotation: a second-generation analysis of chromosome 22.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...