Property Summary

NCBI Gene PubMed Count 15
PubMed Score 54.45
PubTator Score 25.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Substance-Related Disorders 115 0.0 0.0
Disease Target Count P-value
malignant mesothelioma 3232 2.2e-05
lung cancer 4740 4.2e-03

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.400 4.2e-03
malignant mesothelioma 1.100 2.2e-05

Synonym

Accession Q9Y3P4 Q6I9X3 Q9UGQ7
Symbols PTAG
C22orf3
HS984G1A

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MHARGPHGQLSPALPLASSVLMLLMSTLWLVGAGPGLVLAPELLLDPWQVHRLLTHALGHTALPGLLLSL      1 - 70
LLLPTVGWQQECHLGTLRFLHASALLALASGLLAVLLAGLGLSSAAGSCGYMPVHLAMLAGEGHRPRRPR     71 - 140
GALPPWLSPWLLLALTPLLSSEPPFLQLLCGLLAGLAYAAGAFRWLEPSERRLQVLQEGVLCRTLAGCWP    141 - 210
LRLLATPGSLAELPVTHPAGVRPPIPGPPYVASPDLWSHWEDSALPPPSLRPVQPTWEGSSEAGLDWAGA    211 - 280
SFSPGTPMWAALDEQMLQEGIQASLLDGPAQEPQSAPWLSKSSVSSLRLQQLERMGFPTEQAVVALAATG    281 - 350
RVEGAVSLLVGGQVGTETLVTHGKGGPAHSEGPGPP                                      351 - 386
//

Text Mined References (15)

PMID Year Title