Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.39
PubTator Score 0.20

Knowledge Summary

Patent (368)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Gene RIF (2)

AA Sequence

MDQSNYSSLHGFILLGFSNHPKMEMILSGVVAIFYLITLVGNTAIILASLLDSQLHTPMYFFLRNLSFLD      1 - 70
LCFTTSIIPQMLVNLWGPDKTISYVGCIIQLYVYMWLGSVECLLLAVMSYDRFTAICKPLHYFVVMNPHL     71 - 140
CLKMIIMIWSISLANSVVLCTLTLNLPTCGNNILDHFLCELPALVKIACVDTTTVEMSVFALGIIIVLTP    141 - 210
LILILISYGYIAKAVLRTKSKASQRKAMNTCGSHLTVVSMFYGTIIYMYLQPGNRASKDQGKFLTLFYTV    211 - 280
ITPSLNPLIYTLRNKDMKDALKKLMRFHHKSTKIKRNCKS                                  281 - 320
//

Text Mined References (7)

PMID Year Title