Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.39
PubTator Score 0.20

Knowledge Summary

Patent (368)

Gene RIF (2)

PMID Text
19851445 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of olfactory receptor, family 2, subfamily W, member 1 (OR2W1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MDQSNYSSLHGFILLGFSNHPKMEMILSGVVAIFYLITLVGNTAIILASLLDSQLHTPMYFFLRNLSFLD      1 - 70
LCFTTSIIPQMLVNLWGPDKTISYVGCIIQLYVYMWLGSVECLLLAVMSYDRFTAICKPLHYFVVMNPHL     71 - 140
CLKMIIMIWSISLANSVVLCTLTLNLPTCGNNILDHFLCELPALVKIACVDTTTVEMSVFALGIIIVLTP    141 - 210
LILILISYGYIAKAVLRTKSKASQRKAMNTCGSHLTVVSMFYGTIIYMYLQPGNRASKDQGKFLTLFYTV    211 - 280
ITPSLNPLIYTLRNKDMKDALKKLMRFHHKSTKIKRNCKS                                  281 - 320
//

Text Mined References (7)

PMID Year Title
24047820 2013 Common variation contributes to the genetic architecture of social communication traits.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.