Property Summary

NCBI Gene PubMed Count 44
Grant Count 19
R01 Count 10
Funding $971,391.37
PubMed Score 73.37
PubTator Score 25.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis -2.700 0.000
non-small cell lung cancer -2.049 0.000
intraductal papillary-mucinous neoplasm ... -1.300 0.006
Hydrolethalus syndrome 1.216 0.006
lung cancer -2.700 0.000
colon cancer -1.600 0.009
lung adenocarcinoma -1.500 0.000
group 4 medulloblastoma 1.200 0.006
lung carcinoma -1.100 0.000
ductal carcinoma in situ -1.200 0.003
invasive ductal carcinoma -1.500 0.001

Gene RIF (17)

PMID Text
25518808 The tumor suppressor DLC2 and Kif1B are central components of a signaling network that guides spindle positioning, cell-cell adhesion and mitotic fidelity.
25053769 meta-analysis of two Caucasian cohorts did not show an association between five aneurysm associated loci and sporadic brain Arteriovenous malformations.
24938595 Dimerization of DLC2 was required for its interaction with GKAP, which, in turn, potentiated GKAP self-association.
24627003 Study describes STARD13 as a tumor suppressor playing a positive role in cancer motility.
24333506 Importance of the regulation of RhoA activity in focal adhesions of astrocytoma cells and StarD13 is a GAP playing a major role in this process.
24253896 The present study further describes the role of StarD13 as a tumor suppressor as well as a Rho GAP.
23316797 In the present review, we discuss the family of RhoGTPases, their regulation and their RhoGAPs, focusing mainly on STARD13. [review]
23175628 RhoGAP protein Stard13 is an essential regulator of pancreas tissue architecture in the mammalian embryo; Stard13 acts by regulating Rho signalling spatially and temporally during pancreas development.
22693547 role of miR-125b in pro-metastasis by targeting STARD13
22614672 Authors detected an increase in p-ERK in StarD13 knockdown cells, uncovering a potential link between Rho GTPases and ERK activation.
More...

AA Sequence

MFSQVPRTPASGCYYLNSMTPEGQEMYLRFDQTTRRSPYRMSRILARHQLVTKIQQEIEAKEACDWLRAA      1 - 70
GFPQYAQLYEDSQFPINIVAVKNDHDFLEKDLVEPLCRRLNTLNKCASMKLDVNFQRKKGDDSDEEDLCI     71 - 140
SNKWTFQRTSRRWSRVDDLYTLLPRGDRNGSPGGTGMRNTTSSESVLTDLSEPEVCSIHSESSGGSDSRS    141 - 210
QPGQCCTDNPVMLDAPLVSSSLPQPPRDVLNHPFHPKNEKPTRARAKSFLKRMETLRGKGAHGRHKGSGR    211 - 280
TGGLVISGPMLQQEPESFKAMQCIQIPNGDLQNSPPPACRKGLPCSGKSSGESSPSEHSSSGVSTPCLKE    281 - 350
RKCHEANKRGGMYLEDLDVLAGTALPDAGDQSRMHEFHSQENLVVHIPKDHKPGTFPKALSIESLSPTDS    351 - 420
SNGVNWRTGSISLGREQVPGAREPRLMASCHRASRVSIYDNVPGSHLYASTGDLLDLEKDDLFPHLDDIL    421 - 490
QHVNGLQEVVDDWSKDVLPELQTHDTLVGEPGLSTFPSPNQITLDFEGNSVSEGRTTPSDVERDVTSLNE    491 - 560
SEPPGVRDRRDSGVGASLTRPNRRLRWNSFQLSHQPRPAPASPHISSQTASQLSLLQRFSLLRLTAIMEK    561 - 630
HSMSNKHGWTWSVPKFMKRMKVPDYKDKAVFGVPLIVHVQRTGQPLPQSIQQALRYLRSNCLDQVGLFRK    631 - 700
SGVKSRIHALRQMNENFPENVNYEDQSAYDVADMVKQFFRDLPEPLFTNKLSETFLHIYQYVSKEQRLQA    701 - 770
VQAAILLLADENREVLQTLLCFLNDVVNLVEENQMTPMNLAVCLAPSLFHLNLLKKESSPRVIQKKYATG    771 - 840
KPDQKDLNENLAAAQGLAHMIMECDRLFEVPHELVAQSRNSYVEAEIHVPTLEELGTQLEESGATFHTYL    841 - 910
NHLIQGLQKEAKEKFKGWVTCSSTDNTDLAFKKVGDGNPLKLWKASVEVEAPPSVVLNRVLRERHLWDED    911 - 980
FVQWKVVETLDRQTEIYQYVLNSMAPHPSRDFVVLRTWKTDLPKGMCTLVSLSVEHEEAQLLGGVRAVVM    981 - 1050
DSQYLIEPCGSGKSRLTHICRIDLKGHSPEWYSKGFGHLCAAEVARIRNSFQPLIAEGPETKI          1051 - 1113
//

Text Mined References (46)

PMID Year Title
25518808 2014 The tumour suppressor DLC2 ensures mitotic fidelity by coordinating spindle positioning and cell-cell adhesion.
25053769 2015 Evaluation of genetic risk loci for intracranial aneurysms in sporadic arteriovenous malformations of the brain.
24938595 2014 The stoichiometry of scaffold complexes in living neurons - DLC2 functions as a dimerization engine for GKAP.
24627003 2014 StarD13 is a tumor suppressor in breast cancer that regulates cell motility and invasion.
24535457 2014 A genome-wide association meta-analysis of plasma A? peptides concentrations in the elderly.
24333506 2014 The regulation of RhoA at focal adhesions by StarD13 is important for astrocytoma cell motility.
24253896 2014 Effect of StarD13 on colorectal cancer proliferation, motility and invasion.
23942779 2013 A genome-wide association study of behavioral disinhibition.
23517042 2013 Genome-wide association study of body mass index in 23 000 individuals with and without asthma.
23316797 2013 The STAR of the DLC family.
More...