Property Summary

NCBI Gene PubMed Count 36
Grant Count 33
R01 Count 24
Funding $2,609,757.73
PubMed Score 192.44
PubTator Score 16.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
tuberculosis and treatment for 6 months -1.200 0.000
posterior fossa group B ependymoma 1.300 0.000
ovarian cancer 1.200 0.005

Gene RIF (24)

PMID Text
26147002 CBY1 downregulation in CML comes from reduced protein stability when bound to 14-3-3sigma adapter protein. Dissociation raises CBY1 protein levels by enhancing its stability. The ubiquitin proteasome system reduces 14-3-3sigma-bound CBY1 stability by SUMOylation.
25389112 Results show the hypermethylation of CBY1 and BCL2-like11 promoters proceeding from DNMT1 is a crucial component of their reduced expression, but it is not directly involved in chronic myeloid leukemia resistance to imatinib.
25175341 Study showed that expression of Cby protein was strongly downregulated in laryngeal squamous cell carcinoma (LSCC) tumor tissues in comparison to normal laryngeal mucosa samples.
24339928 the impact of BCR-ABL1 on Chibby1, a beta catenin antagonist involved in cell differentiation and transformation
23838289 C-terminal polycystin-2 influences the interaction with PIGEA14
23707389 Stable expression of CBY1 drives beta catenin cytoplasmatic translocation and impairs beta catenin signaling in BCR-ABL + cells.
23645032 Results from the association analysis suggest that common variation in CBY is not a cause for obesity in the Belgian population.
22911743 Cby plays an important role in organization of both primary and motile cilia in collaboration with Cnx.
21182262 The N-terminal portion of the CBY1 is unstructured in solution, but the C-terminal half forms a coiled-coil structure.
20140262 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MPFFGNTFSPKKTPPRKSASLSNLHSLDRSTREVELGLEYGSPTMNLAGQSLKFENGQWIAETGVSGGVD      1 - 70
RREVQRLRRRNQQLEEENNLLRLKVDILLDMLSESTAESHLMEKELDELRISRKRK                   71 - 126
//

Text Mined References (39)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26147002 2015 14-3-3 Binding and Sumoylation Concur to the Down-Modulation of ?-catenin Antagonist chibby 1 in Chronic Myeloid Leukemia.
25416956 2014 A proteome-scale map of the human interactome network.
25389112 2015 DNA methyltransferase 1 drives transcriptional down-modulation of ? catenin antagonist Chibby1 associated with the BCR-ABL1 gene of chronic myeloid leukemia.
25175341 2014 Downregulated Chibby in laryngeal squamous cell carcinoma with increased expression in laryngeal carcinoma Hep-2 cells.
24339928 2013 BCR-ABL1-associated reduction of beta catenin antagonist Chibby1 in chronic myeloid leukemia.
23838289 2013 Phosphorylation of C-terminal polycystin-2 influences the interaction with PIGEA14: a QCM study based on solid supported membranes.
23707389 2013 Chibby drives ? catenin cytoplasmic accumulation leading to activation of the unfolded protein response in BCR-ABL1+ cells.
23645032 2013 No important role for genetic variation in the Chibby gene in monogenic and complex obesity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...