Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.90
PubTator Score 4.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession Q9Y3L5 B3KWD6 Q5H9H9 Q9BTS0
Symbols

Gene

Gene RIF (3)

PMID Text
23885123 JAM-A regulates epithelial permeability via association with ZO-2, afadin, and PDZ-GEF1 to activate Rap2c and control contraction of the apical cytoskeleton.
17447155 RAP2C is a novel member of the Ras family, belonging to the Rap branch of small GTPase proteins and may be involved in SRE-mediated gene transcription.
16213650 This work demonstrates that Rap2C is a new member of the Rap2 subfamily of proteins, able to bind guanine nucleotides with peculiar properties, and differently expressed by various hematopoietic subsets

AA Sequence

MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDL      1 - 70
YIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVKRYEKVPLILVGNKVDLEPEREVMSSEGRALAQEWGC     71 - 140
PFMETSAKSKSMVDELFAEIVRQMNYSSLPEKQDQCCTTCVVQ                               141 - 183
//

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23885123 2013 JAM-A associates with ZO-2, afadin, and PDZ-GEF1 to activate Rap2c and regulate epithelial barrier function.
22797597 2012 Rap2A links intestinal cell polarity to brush border formation.
21668950 2011 A computational approach to candidate gene prioritization for X-linked mental retardation using annotation-based binary filtering and motif-based linear discriminatory analysis.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19784953 2009 A novel approach to tag and identify geranylgeranylated proteins.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17690704 2007 Combined high-resolution array-based comparative genomic hybridization and expression profiling of ETV6/RUNX1-positive acute lymphoblastic leukemias reveal a high incidence of cryptic Xq duplications and identify several putative target genes within the commonly gained region.
17447155 2007 Cloning and characterization of the human gene RAP2C, a novel member of Ras family, which activates transcriptional activities of SRE.
More...