Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.67
PubTator Score 4.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.600 4.1e-02
malignant mesothelioma 1.100 4.3e-05
medulloblastoma, large-cell -1.200 5.0e-05
Multiple myeloma 1.388 8.7e-03
ovarian cancer -2.000 5.3e-06
pediatric high grade glioma 1.400 2.4e-04
primary Sjogren syndrome 1.100 1.2e-02
Rheumatoid arthritis 1.400 2.7e-02

Gene RIF (3)

AA Sequence

MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDL      1 - 70
YIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVKRYEKVPLILVGNKVDLEPEREVMSSEGRALAQEWGC     71 - 140
PFMETSAKSKSMVDELFAEIVRQMNYSSLPEKQDQCCTTCVVQ                               141 - 183
//

Text Mined References (18)

PMID Year Title