Property Summary

NCBI Gene PubMed Count 37
Grant Count 44
R01 Count 30
Funding $7,608,383.28
PubMed Score 20.58
PubTator Score 638.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.180 0.018
astrocytic glioma -1.400 0.012
ependymoma -1.300 0.032
oligodendroglioma -1.200 0.022
osteosarcoma -1.267 0.000
lung cancer 1.400 0.000
ovarian cancer 1.500 0.015

 GO Function (1)

Gene RIF (19)

PMID Text
26373288 MAWD and MAWBP were downregulated and associated with the differentiation grade in GC tissues.
25483064 STRAP inhibits the transactivation function of Sp1 either by directly blocking its DNA binding domain or destabilizing Sp1 protein through ubiquitin-proteasome pathway in cell cycle G1 phase.
25168243 Strap augments the apoptotic effects of mitochondrial p53.
23918805 Data indicate serine-threonine kinase receptor-associated protein (STRAP) as a novel regulator of the coordinated translation of collagen alpha1(I) and alpha2(I) mRNAs.
23687415 Coexpression of MAWBP and MAWD inhibited epithelial mesenchymal transformation, and EMT-aided malignant cell progression was suppressed in gastric cancer.
22362889 both of the TPR and OB-fold domains localize to the chromatin of p53 target genes and exhibit intrinsic regulatory activity necessary for the Strap-dependent p53 response
22190034 HIV-1 NC is identified to have a physical interaction with serine/threonine kinase receptor associated protein (STRAP) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21502811 STRAP protein decreases ubiquitination of intracellular domain of Notch3 and may help to stabilize it.
21148321 B-MYB acts as a positive regulator of STRAP
20144149 gonucleotide pulldown identified STRAP (serine/threonine kinase receptor-associated protein) as a further protein recruited to the MMP28 promoter and acting functionally with Sp1.
More...

AA Sequence

MAMRQTPLTCSGHTRPVVDLAFSGITPYGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNKD      1 - 70
ATKAATAAADFTAKVWDAVSGDELMTLAHKHIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEIS     71 - 140
GHTSGIKKALWCSEDKQILSADDKTVRLWDHATMTEVKSLNFNMSVSSMEYIPEGEILVITYGRSIAFHS    141 - 210
AVSLDPIKSFEAPATINSASLHPEKEFLVAGGEDFKLYKYDYNSGEELESYKGHFGPIHCVRFSPDGELY    211 - 280
ASGSEDGTLRLWQTVVGKTYGLWKCVLPEEDSGELAKPKIGFPETTEEELEEIASENSDCIFPSAPDVKA    281 - 350
//

Text Mined References (43)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26373288 2015 Mitogen-activated protein kinase activator with WD40 repeats (MAWD) and MAWD-binding protein induce cell differentiation in gastric cancer.
25483064 2014 Oncogenic STRAP functions as a novel negative regulator of E-cadherin and p21(Cip1) by modulating the transcription factor Sp1.
25168243 2015 Cofactor Strap regulates oxidative phosphorylation and mitochondrial p53 activity through ATP synthase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23918805 2013 Serine-threonine kinase receptor-associated protein (STRAP) regulates translation of type I collagen mRNAs.
23687415 2013 MAWBP and MAWD inhibit proliferation and invasion in gastric cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...