Property Summary

NCBI Gene PubMed Count 40
PubMed Score 23.86
PubTator Score 638.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Colorectal Neoplasms 243 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 6.8e-06
lung cancer 4740 5.3e-03
astrocytic glioma 2597 1.2e-02
ovarian cancer 8520 1.5e-02
Multiple myeloma 1332 1.8e-02
oligodendroglioma 2850 2.2e-02
ependymoma 4679 3.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Muscular atrophy 71 4.359 2.2
Spinal muscular atrophy 34 4.032 2.0

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.400 1.2e-02
ependymoma -1.300 3.2e-02
lung cancer 1.300 5.3e-03
Multiple myeloma 1.180 1.8e-02
oligodendroglioma -1.200 2.2e-02
osteosarcoma -1.267 6.8e-06
ovarian cancer 1.500 1.5e-02

 IMPC Phenotype (1)

Gene RIF (21)

AA Sequence

MAMRQTPLTCSGHTRPVVDLAFSGITPYGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNKD      1 - 70
ATKAATAAADFTAKVWDAVSGDELMTLAHKHIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEIS     71 - 140
GHTSGIKKALWCSEDKQILSADDKTVRLWDHATMTEVKSLNFNMSVSSMEYIPEGEILVITYGRSIAFHS    141 - 210
AVSLDPIKSFEAPATINSASLHPEKEFLVAGGEDFKLYKYDYNSGEELESYKGHFGPIHCVRFSPDGELY    211 - 280
ASGSEDGTLRLWQTVVGKTYGLWKCVLPEEDSGELAKPKIGFPETTEEELEEIASENSDCIFPSAPDVKA    281 - 350
//

Text Mined References (46)

PMID Year Title