Knowledge Summary

Patent

No data available

Synonym

Accession Q9Y3F1
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MSLLWTPQILTISFVSYILSLFPSPFPSCYTSCWFETSITTEKELNQYFELAKFLA                    1 - 56
//