Property Summary

NCBI Gene PubMed Count 46
PubMed Score 32.75
PubTator Score 24.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung adenocarcinoma 2714 8.48199824128774E-16
ovarian cancer 8492 6.63713611180552E-9
osteosarcoma 7933 1.88765009072355E-7
atypical teratoid / rhabdoid tumor 4369 1.6966363617931E-6
medulloblastoma, large-cell 6234 8.37756035286666E-5
lung cancer 4473 0.00254741325251909
Multiple myeloma 1328 0.00612262645661606
Breast cancer 3099 0.0432884395263116
Disease Target Count Z-score Confidence
Brain glioma 10 3.111 1.6

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.007 0.006
osteosarcoma 2.180 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
medulloblastoma, large-cell -1.200 0.000
lung cancer -1.200 0.003
Breast cancer 2.700 0.043
lung adenocarcinoma -1.600 0.000
ovarian cancer -2.000 0.000

Synonym

Accession Q9Y3E7 A8K3W0 B4DG34 B8ZZM0 B8ZZX5 Q3ZTS9 Q53S71 Q53SU5 Q9NZ51
Symbols NEDF
VPS24
CGI-149

Gene

PANTHER Protein Class (1)

PDB

2GD5   2XZE   3FRT   3FRV  

Gene RIF (16)

PMID Text
24440309 Protein kinase CK2 alpha is involved in the phosphorylation of the ESCRT-III subunits CHMP3 and CHMP2B, as well as of VPS4B/SKD1, an ATPase that mediates ESCRT-III disassembly.
23051622 Recruitment of CHMP2A and CHMP3 by CHMP4B to HIV-1 Gag puncta is observed in in-vitro membrane model
23027949 Recruitment of CHMP2A and CHMP3 by CHMP4B to HIV-1 Gag puncta is observed in in-vitro membrane model
21827950 tight coupling of ESCRT-III CHMP3 and AMSH functions and provide insight into the regulation of ESCRT-III
20427536 Recruitment of CHMP2A and CHMP3 by CHMP4B to HIV-1 Gag puncta is observed in in-vitro membrane model
19525971 Data show that the N-terminal core domains of increased sodium tolerance-1 (IST1) and charged multivesicular body protein-3 (CHMP3) form equivalent four-helix bundles, revealing that IST1 is a previously unrecognized ESCRT-III family member.
18687924 study found the ESCRT-III proteins CHMP2A & CHMP3 could assemble in vitro into helical tubular structures that expose their membrane interaction sites on the outside of the tubule; VPS4 could bind on the inside of the tubule & disassemble the tubes
17711858 UBPY MIT domain and another ubiquitin isopeptidase, AMSH, reveals common interactions with CHMP1A and CHMP1B but a distinct selectivity of AMSH for CHMP3/VPS24, a core subunit of the ESCRT-III complex, and UBPY for CHMP7.
17686835 expression of dominant negative forms of Vps4 and Vps24, two components of the MVB pathway, rresult in an impairment in infectious herpes simplex virus assembly/egress
17331679 Data demonstrate that the VPS24 gene gives rise to two functionally distinct proteins, one of which is involved in the ESCRT pathway and another novel protein that serves an anti-apoptotic role.
More...

AA Sequence

MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRS      1 - 70
RKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGII     71 - 140
EEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEAL    141 - 210
EAMQSRLATLRS                                                              211 - 222
//

Text Mined References (55)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
24878737 2014 Structure of cellular ESCRT-III spirals and their relationship to HIV budding.
24440309 2014 CK2 involvement in ESCRT-III complex phosphorylation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23105106 2012 Interactions of the human LIP5 regulatory protein with endosomal sorting complexes required for transport.
23051622 2013 ESCRT-III CHMP2A and CHMP3 form variable helical polymers in vitro and act synergistically during HIV-1 budding.
22660413 2012 Syndecan-syntenin-ALIX regulates the biogenesis of exosomes.
21827950 2011 Structural basis for ESCRT-III CHMP3 recruitment of AMSH.
More...