Property Summary

NCBI Gene PubMed Count 46
PubMed Score 35.55
PubTator Score 24.61

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 1.7e-06
Breast cancer 2.700 4.3e-02
lung adenocarcinoma -1.600 8.5e-16
lung cancer -1.200 2.5e-03
medulloblastoma, large-cell -1.200 8.4e-05
Multiple myeloma 1.007 6.1e-03
osteosarcoma 2.180 1.9e-07
ovarian cancer -2.000 6.6e-09

 MGI Phenotype (1)

Gene RIF (16)

AA Sequence

MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRS      1 - 70
RKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGII     71 - 140
EEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEAL    141 - 210
EAMQSRLATLRS                                                              211 - 222
//

Text Mined References (55)

PMID Year Title