Property Summary

NCBI Gene PubMed Count 23
Grant Count 23
R01 Count 4
Funding $2,761,023.94
PubMed Score 33.67
PubTator Score 17.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.100 0.005
lung cancer 2.000 0.001
invasive ductal carcinoma 1.500 0.003
ovarian cancer 1.200 0.001

Gene RIF (14)

PMID Text
26956728 Bit1 may be an important regulator in cell growth, apoptosis, migration and invasion of esophageal squamous cell carcinoma via targeting FAK-paxillin pathway.
25211327 Reduction of the Bit1 level in cytosol, regulated by E2 binding to ESR1, was mainly mediated through PI3K/AKT pathways.
25003198 these findings suggest a tumor suppressive role of the caspase-independent anoikis effector Bit1 in lung cancer.
23955799 Bit1 plays pivotal roles in the development and progression of ESCC, and its biological functions in ESCC may be closely associated with AIF and Bcl-2 levels.
23259782 Bit1 may be a useful pathological marker and a prognostic marker for serous papillary adenocarcinomas outcome.
23248118 Data indicate that the cell death domain (CDD) to the N-terminal 62 amino acids of Bit1 was more potent in killing cells than the full-length Bit1 protein when equivalent amounts of cDNA were transfected.
22952044 TLE1 inhibits the Bit1 anoikis pathway by reducing the formation of the proapoptotic Bit1-AES complex in part through sequestration of AES in the nucleus.
21886829 downregulation of Bit1 conferred cancer cells with enhanced anoikis resistance, adhesive and migratory properties in vitro
21383007 Bit-1 mediates integrin-dependent cell survival through activation of the NFkappaB pathway
20877624 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MPSKSLVMEYLAHPSTLGLAVGVACGMCLGWSLRVCFGMLPKSKTSKTHTDTESEASILGDSGEYKMILV      1 - 70
VRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTV     71 - 140
SLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY                                   141 - 179
//

Text Mined References (29)

PMID Year Title
26956728 2016 Bit1 knockdown contributes to growth suppression as well as the decreases of migration and invasion abilities in esophageal squamous cell carcinoma via suppressing FAK-paxillin pathway.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25621951 2015 USP30 and parkin homeostatically regulate atypical ubiquitin chains on mitochondria.
25574476 2014 Mutations in PTRH2 cause novel infantile-onset multisystem disease with intellectual disability, microcephaly, progressive ataxia, and muscle weakness.
25558065 2015 Accelerating novel candidate gene discovery in neurogenetic disorders via whole-exome sequencing of prescreened multiplex consanguineous families.
25211327 2014 Estrogen decreases anoikis of ovarian cancer cell line Caov-3 through reducing release of Bit1.
25003198 2014 The anoikis effector Bit1 displays tumor suppressive function in lung cancer cells.
23955799 2014 Implications of Bit1 and AIF overexpressions in esophageal squamous cell carcinoma.
23259782 2013 Pathological implication and function of Bcl2-inhibitor of transcription in ovarian serous papillary adenocarcinomas.
23248118 2013 Application of a proapoptotic peptide to intratumorally spreading cancer therapy.
More...