Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.34
PubTator Score 2.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.100 2.0e-03
malignant mesothelioma 1.300 1.9e-06
medulloblastoma, large-cell -1.100 2.9e-02

Synonym

Accession Q9Y3E2 B2R7K2 D3DUZ4 Q5QNY0
Symbols CGI-143

Gene

PDB

5LCI  

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (4)

AA Sequence

MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRV      1 - 70
AVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP        71 - 137
//

Text Mined References (18)

PMID Year Title