Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.29
PubTator Score 9.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma -1.400 8.5e-03
astrocytic glioma -1.300 4.0e-02
Astrocytoma, Pilocytic -1.100 3.5e-03
atypical teratoid / rhabdoid tumor -1.600 4.7e-03
Breast cancer 2.400 3.6e-02
colon cancer -2.300 2.6e-02
Duchenne muscular dystrophy 1.060 4.3e-06
ependymoma -1.900 3.3e-02
gastric cancer 1.100 6.5e-03
glioblastoma -1.100 8.2e-04
intraductal papillary-mucinous adenoma (... -1.300 8.5e-04
intraductal papillary-mucinous carcinoma... -2.000 5.5e-05
juvenile dermatomyositis 1.208 1.3e-09
lung adenocarcinoma -1.200 1.2e-05
lung cancer -1.400 1.0e-02
lung carcinoma 1.400 2.0e-22
malignant mesothelioma 1.600 8.7e-07
medulloblastoma, large-cell -1.100 6.9e-04
nasopharyngeal carcinoma 1.200 1.4e-03
osteosarcoma -2.790 3.0e-07
ovarian cancer -1.100 7.5e-03
psoriasis -2.100 9.7e-05
ulcerative colitis 1.400 8.2e-04

Synonym

Accession Q9Y3E1 HRP-3
Symbols HDGF2
HRP-3
HDGF-2
CGI-142
HDGFRP3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MARPRPREYKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGTHETAFLGPKDLFPYKEYKD      1 - 70
KFGKSNKRKGFNEGLWEIENNPGVKFTGYQAIQQQSSSETEGEGGNTADASSEEEGDRVEEDGKGKRKNE     71 - 140
KAGSKRKKSYTSKKSSKQSRKSPGDEDDKDCKEEENKSSSEGGDAGNDTRNTTSDLQKTSEGT           141 - 203
//

Text Mined References (13)

PMID Year Title