1. Home
  2. Targets
  3. transcription factor
  4. transcription cofactor
  5. Hepatoma-derived growth factor-related protein 3

Tbio Hepatoma-derived growth factor-related protein 3

Enhances DNA synthesis and may play a role in cell proliferation.

 Comments

Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.12
PubTator Score 9.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.98328264415209E-22
juvenile dermatomyositis 1189 1.2760015335987E-9
osteosarcoma 7933 3.04143914920082E-7
malignant mesothelioma 3163 8.70452704838698E-7
Duchenne muscular dystrophy 602 4.34009388231239E-6
lung adenocarcinoma 2714 1.18453668021522E-5
psoriasis 6685 9.65393605921796E-5
glioblastoma 5572 1.34208715452094E-4
lung cancer 4473 1.40478017353445E-4
ovarian cancer 8492 2.34162889501081E-4
nasopharyngeal carcinoma 1056 2.57143040708118E-4
adult high grade glioma 2148 3.51460555041523E-4
medulloblastoma, large-cell 6234 3.88232295741592E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.53597875009737E-4
ulcerative colitis 2087 8.18802432451453E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 8.47555045361283E-4
atypical teratoid / rhabdoid tumor 4369 9.524007221802E-4
astrocytoma 1493 0.00273903391586518
pilocytic astrocytoma 3086 0.00424413270680635
gastric cancer 436 0.00645945019124472
colon cancer 1475 0.0260146276270096
ependymoma 2514 0.033435231473486
Breast cancer 3099 0.0355700541190263
Disease Target Count Z-score Confidence
Congenital diaphragmatic hernia 44 3.197 1.6

Expression

  Differential Expression (23)

Disease log2 FC p
gastric cancer 1.100 0.006
malignant mesothelioma 1.600 0.000
astrocytoma -2.100 0.003
ependymoma -1.900 0.033
psoriasis -2.100 0.000
glioblastoma -1.800 0.000
osteosarcoma -2.790 0.000
atypical teratoid / rhabdoid tumor -1.700 0.001
medulloblastoma, large-cell -1.300 0.000
Duchenne muscular dystrophy 1.060 0.000
juvenile dermatomyositis 1.208 0.000
intraductal papillary-mucinous adenoma (... -1.300 0.001
intraductal papillary-mucinous carcinoma... -2.700 0.001
colon cancer -2.300 0.026
lung cancer -2.100 0.000
Breast cancer 2.400 0.036
adult high grade glioma -1.700 0.000
pilocytic astrocytoma -1.100 0.004
lung adenocarcinoma -1.200 0.000
nasopharyngeal carcinoma 1.400 0.000
lung carcinoma 1.400 0.000
ulcerative colitis 1.400 0.001
ovarian cancer 1.500 0.000

Synonym

Accession Q9Y3E1 HRP-3
Symbols HDGF2
HRP-3
HDGF-2
CGI-142

Gene

HDGFRP3

PANTHER Protein Class (2)

 GO Function (2)

 GO Component (3)

 GO Process (4)

 Compartment GO Term (21)

See all...

 UniProt Keyword (5)

Gene RIF (4)

PMID Text
26823754 Glucose deprivation-induced HRP-3 up-regulation potentially plays a major role in protecting hepatocellular carcinoma cells against apoptosis caused by energy pressure.
24012673 Depletion of HRP-3 induces apoptosis of radio- and chemoresistant A549 cells. HRP-3 is essential for regulating reactive oxygen species-dependent, p53-induced cell death.
19237540 Hepatoma-derived growth factor-related protein-3 interacts with microtubules and promotes neurite outgrowth in mouse cortical neurons
15371438 LEDGF/p75 and HRP2 IBDs avidly bind HIV-1 Integrase, share a similar domain organization and have an evident evolutionary and likely functional relationship

AA Sequence 

MARPRPREYKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGTHETAFLGPKDLFPYKEYKD      1 - 70
KFGKSNKRKGFNEGLWEIENNPGVKFTGYQAIQQQSSSETEGEGGNTADASSEEEGDRVEEDGKGKRKNE     71 - 140
KAGSKRKKSYTSKKSSKQSRKSPGDEDDKDCKEEENKSSSEGGDAGNDTRNTTSDLQKTSEGT           141 - 203
//

Text Mined References (12)

PMID Year Title
26823754 2015 HRP-3 protects the hepatoma cells from glucose deprivation-induced apoptosis.
24012673 2013 Depletion of hepatoma-derived growth factor-related protein-3 induces apoptotic sensitization of radioresistant A549 cells via reactive oxygen species-dependent p53 activation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19237540 2009 Hepatoma-derived growth factor-related protein-3 interacts with microtubules and promotes neurite outgrowth in mouse cortical neurons.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15371438 2004 Identification of an evolutionarily conserved domain in human lens epithelium-derived growth factor/transcriptional co-activator p75 (LEDGF/p75) that binds HIV-1 integrase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...