Property Summary

NCBI Gene PubMed Count 11
Grant Count 3
Funding $250,339.5
PubMed Score 2.12
PubTator Score 9.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
gastric cancer 1.100 0.006
malignant mesothelioma 1.600 0.000
astrocytoma -2.100 0.003
ependymoma -1.900 0.033
psoriasis -2.100 0.000
glioblastoma -1.800 0.000
osteosarcoma -2.790 0.000
atypical teratoid / rhabdoid tumor -1.700 0.001
medulloblastoma, large-cell -1.300 0.000
Duchenne muscular dystrophy 1.060 0.000
juvenile dermatomyositis 1.208 0.000
intraductal papillary-mucinous adenoma (... -1.300 0.001
intraductal papillary-mucinous carcinoma... -2.700 0.001
colon cancer -2.300 0.026
lung cancer -2.100 0.000
Breast cancer 2.400 0.036
adult high grade glioma -1.700 0.000
pilocytic astrocytoma -1.100 0.004
lung adenocarcinoma -1.200 0.000
nasopharyngeal carcinoma 1.400 0.000
lung carcinoma 1.400 0.000
ulcerative colitis 1.400 0.001
ovarian cancer 1.500 0.000

Synonym

Accession Q9Y3E1 HRP-3
Symbols HDGF2
HRP-3
HDGF-2
CGI-142

Gene

Gene RIF (4)

PMID Text
26823754 Glucose deprivation-induced HRP-3 up-regulation potentially plays a major role in protecting hepatocellular carcinoma cells against apoptosis caused by energy pressure.
24012673 Depletion of HRP-3 induces apoptosis of radio- and chemoresistant A549 cells. HRP-3 is essential for regulating reactive oxygen species-dependent, p53-induced cell death.
19237540 Hepatoma-derived growth factor-related protein-3 interacts with microtubules and promotes neurite outgrowth in mouse cortical neurons
15371438 LEDGF/p75 and HRP2 IBDs avidly bind HIV-1 Integrase, share a similar domain organization and have an evident evolutionary and likely functional relationship

AA Sequence

MARPRPREYKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGTHETAFLGPKDLFPYKEYKD      1 - 70
KFGKSNKRKGFNEGLWEIENNPGVKFTGYQAIQQQSSSETEGEGGNTADASSEEEGDRVEEDGKGKRKNE     71 - 140
KAGSKRKKSYTSKKSSKQSRKSPGDEDDKDCKEEENKSSSEGGDAGNDTRNTTSDLQKTSEGT           141 - 203
//

Text Mined References (12)

PMID Year Title
26823754 2015 HRP-3 protects the hepatoma cells from glucose deprivation-induced apoptosis.
24012673 2013 Depletion of hepatoma-derived growth factor-related protein-3 induces apoptotic sensitization of radioresistant A549 cells via reactive oxygen species-dependent p53 activation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19237540 2009 Hepatoma-derived growth factor-related protein-3 interacts with microtubules and promotes neurite outgrowth in mouse cortical neurons.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15371438 2004 Identification of an evolutionarily conserved domain in human lens epithelium-derived growth factor/transcriptional co-activator p75 (LEDGF/p75) that binds HIV-1 integrase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...