Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.85
PubTator Score 2.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.334 0.001
cutaneous lupus erythematosus 1.100 0.000
osteosarcoma 2.112 0.000
juvenile dermatomyositis 1.245 0.000
acute quadriplegic myopathy 1.085 0.000
tuberculosis and treatment for 3 months -1.100 0.000
active Crohn's disease 1.074 0.012
diabetes mellitus -1.200 0.005
Pick disease -1.300 0.000
Breast cancer 1.100 0.000
ulcerative colitis 1.200 0.000
ovarian cancer 2.000 0.001

Synonym

Accession Q9Y3E0 B2R4R4 Q54A40 Q6I9W6 Q9P1R9
Symbols GCT2
GOT1
GOT1B
CGI-141
YMR292W

Gene

 GO Function (1)

AA Sequence

MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFFQKHKMKATGF      1 - 70
FLGGVFVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLNLPGIRSFVDKVGESNNMV       71 - 138
//

Text Mined References (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
19946888 2010 Defining the membrane proteome of NK cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...