Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.85
PubTator Score 2.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
active Crohn's disease 1.074 1.2e-02
acute quadriplegic myopathy 1.085 2.3e-04
Breast cancer 1.100 3.1e-08
cutaneous lupus erythematosus 1.100 3.4e-04
diabetes mellitus -1.200 4.8e-03
juvenile dermatomyositis 1.245 4.1e-10
Multiple myeloma 1.334 1.4e-03
osteosarcoma 2.112 2.9e-05
ovarian cancer 2.000 1.0e-03
Pick disease -1.300 1.4e-04
tuberculosis and treatment for 3 months -1.100 4.0e-05
ulcerative colitis 1.200 2.5e-06

 GO Function (1)

AA Sequence

MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFFQKHKMKATGF      1 - 70
FLGGVFVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLNLPGIRSFVDKVGESNNMV       71 - 138
//

Text Mined References (15)

PMID Year Title