Property Summary

NCBI Gene PubMed Count 17
PubMed Score 215.00
PubTator Score 4.89

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 4.54682860081425E-5
progressive supranuclear palsy 674 0.00556017100723865
Disease Target Count Z-score Confidence
Cancer 2346 3.875 1.9
Spinocerebellar ataxia type 7 13 3.687 1.8


  Differential Expression (2)

Disease log2 FC p
progressive supranuclear palsy -1.200 0.006
ovarian cancer -1.200 0.000


Accession Q9Y3D8 A8MSZ6 Q5F2S9 AK6
Symbols CIP




1RKB   3IIJ   3IIK   3IIL   3IIM   5JZV  

Gene RIF (2)

16079131 hCINAP is a novel coilin-interacting protein encoded by a transcript from the transcription factor TAFIID32 locus
15213396 purification and X ray crystal structure

AA Sequence

VHQLPSNKPEELENNVDQILKWIEQWIKDHNS                                          141 - 172

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23246961 2014 hCINAP is a novel regulator of ribosomal protein-HDM2-p53 pathway by controlling NEDDylation of ribosomal protein S14.
22038794 2012 hCINAP is an atypical mammalian nuclear adenylate kinase with an ATPase motif: structural and functional studies.
21269460 2011 Initial characterization of the human central proteome.
20974138 2010 The nuclear ATPase/adenylate kinase hCINAP is recruited to perinucleolar caps generated upon RNA pol.II inhibition.
20186459 2010 Depletion of hCINAP by RNA interference causes defects in Cajal body formation, histone transcription, and cell viability.
19946888 2010 Defining the membrane proteome of NK cells.
16079131 2005 Characterization of hCINAP, a novel coilin-interacting protein encoded by a transcript from the transcription factor TAFIID32 locus.
15630091 2005 The crystal structure of human adenylate kinase 6: An adenylate kinase localized to the cell nucleus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).