Property Summary

NCBI Gene PubMed Count 52
Grant Count 86
R01 Count 57
Funding $10,565,363.31
PubMed Score 129.89
PubTator Score 67.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.002 0.012
Multiple myeloma 1.653 0.000
medulloblastoma, large-cell -1.400 0.000
Polycystic Ovary Syndrome 1.139 0.020
ovarian cancer 2.100 0.000

Synonym

Accession Q9Y3D6 Q9BTP3
Symbols TTC11
CGI-135

Gene

PDB

1NZN   1PC2  

 GO Function (1)

Gene RIF (33)

PMID Text
25843291 Study revealed that a novel mitochondrial fission pathway composed of miR-483-5p and FIS1 regulates cisplatin sensitivity.
25822260 Results show that Fis1 is significantly overexpressed in malignant oncocytomas.
24416201 PDCD7, Ang2 and FIS1 may indicate a more aggressive form and poor prognosis of acute myeloid leukemia.
23921378 MiD49 and MiD51 can act independently of Mff and Fis1 in Drp1 recruitment and suggest that they provide specificity to the division of mitochondria.
23907611 Overexpression of FoxM1 and Plk1 in Fis1-depleted cells restores mitotic entry.
23713734 Fis1 expression is significantly increased in spinal cord in a transgenic mouse model of amyotrophic lateral sclerosis.
23077178 Fis1 acts as a mitochondrial recruitment factor for TBC1D15 that is involved in regulation of mitochondrial morphology.
22789569 Fis1 activity depends on its ability to interconvert between monomer and dimer species
22595523 PEX11 proteins attract both Mff and human Fis1 (hFis1) to their site of action.
22340708 Fis1 and dynamin-related protein (Drp)1 levels are remarkably increased in peripheral blood lymphocytes of Alzheimer's disease patients.
More...

AA Sequence

MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQ      1 - 70
RDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLA     71 - 140
GLIGLAVSKSKS                                                              141 - 152
//

Text Mined References (57)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25843291 2015 miR-483-5p determines mitochondrial fission and cisplatin sensitivity in tongue squamous cell carcinoma by targeting FIS1.
25822260 2015 Mitochondrial dynamics protein Drp1 is overexpressed in oncocytic thyroid tumors and regulates cancer cell migration.
25416956 2014 A proteome-scale map of the human interactome network.
24416201 2014 Identification of novel molecular markers for prognosis estimation of acute myeloid leukemia: over-expression of PDCD7, FIS1 and Ang2 may indicate poor prognosis in pretreatment patients with acute myeloid leukemia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23921378 2013 Adaptor proteins MiD49 and MiD51 can act independently of Mff and Fis1 in Drp1 recruitment and are specific for mitochondrial fission.
23907611 2014 Human mitochondrial Fis1 links to cell cycle regulators at G2/M transition.
23713734 2013 Mitochondrial fusion and fission proteins expression dynamically change in a murine model of amyotrophic lateral sclerosis.
23530241 2013 Interchangeable adaptors regulate mitochondrial dynamin assembly for membrane scission.
More...