Property Summary

NCBI Gene PubMed Count 53
PubMed Score 143.37
PubTator Score 67.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Ceroid lipofuscinosis, neuronal 1, infantile 10 0.0 0.0
Disease Target Count Z-score Confidence
Optic Atrophy 242 5.342 2.7

Expression

  Differential Expression (5)

Disease log2 FC p
medulloblastoma, large-cell -1.400 6.6e-05
Multiple myeloma 1.653 2.6e-04
ovarian cancer -2.000 6.1e-07
Polycystic ovary syndrome 1.139 2.0e-02
Waldenstrons macroglobulinemia 1.002 1.2e-02

Pathway (1)

Gene RIF (36)

AA Sequence

MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQ      1 - 70
RDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLA     71 - 140
GLIGLAVSKSKS                                                              141 - 152
//

Text Mined References (58)

PMID Year Title