Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
acute myeloid leukemia -1.700 2.9e-02
lung cancer 1.900 2.1e-03
malignant mesothelioma -1.700 7.0e-06
osteosarcoma -2.680 1.9e-09
pancreatic ductal adenocarcinoma liver m... -1.640 6.1e-03
psoriasis -1.600 5.5e-04

Synonym

Accession Q9Y3D5 MRP-S18-c
Symbols CGI-134
S18mt-c
MRPS18-1
mrps18-c
MRP-S18-1
MRP-S18-c

Gene

PDB

3J9M  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MAAVVAVCGGLGRKKLTHLVTAAVSLTHPGTHTVLWRRGCSQQVSSNEDLPISMENPYKEPLKKCILCGK      1 - 70
HVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKDPKVCNIRY     71 - 140
RE                                                                        141 - 142
//

Text Mined References (15)

PMID Year Title