Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1.70
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.200 3.3e-03
non primary Sjogren syndrome sicca 1.100 1.6e-02
posterior fossa group A ependymoma 1.100 9.5e-08
subependymal giant cell astrocytoma 1.187 2.7e-02

Gene RIF (5)

AA Sequence

MVHLTTLLCKAYRGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNL      1 - 70
DRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET        71 - 137
//

Text Mined References (23)

PMID Year Title