Property Summary

NCBI Gene PubMed Count 15
Grant Count 6
R01 Count 6
Funding $678,668.8
PubMed Score 1.49
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Gene RIF (5)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
19807034 Mutual effect of human ribosomal proteins S5 and S16 on their binding with 18S rRNA fragment 1203-1236/1521-1698
18539099 The effect of mutated MRPS16 on the assembly of the small and large ribosomal units in human mitochondria is reported.
16385451 Observational study of gene-disease association. (HuGE Navigator)
15505824 Defective mitochondrial translation caused by a ribosomal protein (MRPS16) mutation.

AA Sequence

MVHLTTLLCKAYRGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNL      1 - 70
DRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET        71 - 137
//

Text Mined References (22)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19945174 2010 Identification of human sperm proteins that interact with human zona pellucida3 (ZP3) using yeast two-hybrid system.
19807034 [Mutual effect of human ribosomal proteins S5 and S16 on their binding with 18S rRNA fragment 1203-1236/1521-1698].
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18539099 2008 The effect of mutated mitochondrial ribosomal proteins S16 and S22 on the assembly of the small and large ribosomal subunits in human mitochondria.
More...