Property Summary

NCBI Gene PubMed Count 18
Grant Count 3
R01 Count 1
Funding $99,506.43
PubMed Score 4.69
PubTator Score 6.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.800 0.001
osteosarcoma 1.964 0.000
pancreatic ductal adenocarcinoma liver m... -1.297 0.002
ovarian cancer 1.500 0.000

Synonym

Accession Q9Y3D0
Symbols CIA2B
MIP18
CGI-128

Gene

Gene RIF (5)

PMID Text
24041693 Co-localization experiments by fluorescent confocal microscopy revealed that FAM96B colocalized with prelamin A in HEK-293 cells.
23891004 CIA2B-CIA1-MMS19 and CIA2A-CIA1 assist different branches of Fe/S protein assembly and intimately link this process to cellular iron regulation via IRP1 Fe/S cluster maturation and IRP2 stabilization.
23150669 The mammalian proteins MMS19, MIP18, and ANT2 are involved in cytoplasmic iron-sulfur cluster protein assembly.
22190034 HIV-1 Tat is identified to have a physical interaction with family with sequence similarity 96, member B (FAM96B) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21722264 these findings suggest that FAM96B acts as a regulator of E2-2 through the control of its protein expression.

AA Sequence

MVGGGGVGGGLLENANPLIYQRSGERPVTAGEEDEQVPDSIDAREIFDLIRSINDPEHPLTLEELNVVEQ      1 - 70
VRVQVSDPESTVAVAFTPTIPHCSMATLIGLSIKVKLLRSLPQRFKMDVHITPGTHASEHAVNKQLADKE     71 - 140
RVAAALENTHLLEVVNQCLSARS                                                   141 - 163
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24041693 2013 Identification of FAM96B as a novel prelamin A binding partner.
23891004 2013 Human CIA2A-FAM96A and CIA2B-FAM96B integrate iron homeostasis and maturation of different subsets of cytosolic-nuclear iron-sulfur proteins.
23150669 2012 The mammalian proteins MMS19, MIP18, and ANT2 are involved in cytoplasmic iron-sulfur cluster protein assembly.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22678362 2012 MMS19 assembles iron-sulfur proteins required for DNA metabolism and genomic integrity.
22678361 2012 MMS19 links cytoplasmic iron-sulfur cluster assembly to DNA metabolism.
21722264 2011 Interference of E2-2-mediated effect in endothelial cells by FAM96B through its limited expression of E2-2.
21516116 2011 Next-generation sequencing to generate interactome datasets.
More...