Property Summary

NCBI Gene PubMed Count 18
PubMed Score 9.11
PubTator Score 10.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 9.6e-05
Multiple myeloma 1332 2.4e-04
diabetes mellitus 1728 1.1e-03
Waldenstrons macroglobulinemia 765 1.0e-02
Disease Target Count Z-score Confidence
Alcoholic hepatitis 4 3.109 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus -1.400 1.1e-03
Multiple myeloma 1.565 2.4e-04
ovarian cancer -1.500 9.6e-05
Waldenstrons macroglobulinemia 1.101 1.0e-02

Gene RIF (7)

AA Sequence

MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCW      1 - 70
YIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMAL     71 - 140
GLGPWLAVEIPDLIQKGVIQHKEKCNQ                                               141 - 167
//

Text Mined References (25)

PMID Year Title