Property Summary

NCBI Gene PubMed Count 17
PubMed Score 9.02
PubTator Score 10.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.101 0.010
Multiple myeloma 1.565 0.000
diabetes mellitus -1.400 0.001
ovarian cancer 2.200 0.000

Gene RIF (6)

PMID Text
25449213 UFC1 interact with the mRNA stabilizing protein HuR to increase levels of beta-catenin in hepatocellular carcinoma.
25213431 Autoantibodies binding to Ufc1 were found in 19 of 29 patients (66%) with active mycobacterial infections.
25084390 Uba5 residues 364-404 were demonstrated to be necessary for the transthiolation of Ufm1 to Ufc1, and Uba5 381-404 was identified to be the minimal region for Ufc1 recognition
24726913 NCAM140 interacts with ufc1 and its trafficking and endocytosis is upregulated in the presense of Ufm1.
19101823 The structure of human Ufc1 was solved by using both NMR spectroscopy and X-ray crystallography
15071506 Identification of a novel enzyme called UFC1 for Ufm1-conjugating enzyme 1.

AA Sequence

MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCW      1 - 70
YIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMAL     71 - 140
GLGPWLAVEIPDLIQKGVIQHKEKCNQ                                               141 - 167
//

Text Mined References (24)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25902260 2015 Autism and Intellectual Disability-Associated KIRREL3 Interacts with Neuronal Proteins MAP1B and MYO16 with Potential Roles in Neurodevelopment.
25449213 2015 The long intergenic noncoding RNA UFC1, a target of MicroRNA 34a, interacts with the mRNA stabilizing protein HuR to increase levels of ?-catenin in HCC cells.
25219498 2014 Modification of ASC1 by UFM1 is crucial for ER? transactivation and breast cancer development.
25213431 2015 Autoantibodies binding to ubiquitin-fold modifier-conjugating enzyme 1 (Ufc1) and pleckstrin homology domain containing, family G (with RhoGef domain) member 2 (Plekhg2) are associated with mycobacterial infections.
25084390 2014 Characterization, crystallization and preliminary X-ray crystallographic analysis of the human Uba5 C-terminus-Ufc1 complex.
24726913 2014 Cytoplasmic domain of NCAM140 interacts with ubiquitin-fold modifier-conjugating enzyme-1 (Ufc1).
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23152784 2012 Transcriptional regulation of the Ufm1 conjugation system in response to disturbance of the endoplasmic reticulum homeostasis and inhibition of vesicle trafficking.
21269460 2011 Initial characterization of the human central proteome.
More...