Property Summary

NCBI Gene PubMed Count 14
PubMed Score 14.63
PubTator Score 4.12

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9Y3C7 B2R4L9
Symbols Soh1
CGI-125
3110004H13Rik

Gene

Gene RIF (3)

PMID Text
24969180 Results show that miR-1 is downregulated in osteosarcoma cells but both of its targets Med1 and Med31 were overexpressed suggesting that MiR-1 plays an important role on the proliferation of osteosarcoma cells through regulation of Med1 and Med31.
18976975 Knockdown of MED31 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18976975 Knockdown of mediator complex subunit 31 (MED31) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYP      1 - 70
QCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGK              71 - 131
//

Text Mined References (19)

PMID Year Title
24969180 2014 MicroRNA-1 functions as a potential tumor suppressor in osteosarcoma by targeting Med1 and Med31.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15989967 2005 MED1/TRAP220 exists predominantly in a TRAP/ Mediator subpopulation enriched in RNA polymerase II and is required for ER-mediated transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383276 2004 A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
15175163 2004 A set of consensus mammalian mediator subunits identified by multidimensional protein identification technology.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...