Property Summary

NCBI Gene PubMed Count 17
PubMed Score 7.98
PubTator Score 59.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer 1.200 3.1e-05
ductal carcinoma in situ 1.100 4.0e-04
gastric cancer 1.500 2.6e-03
hepatocellular carcinoma 1.800 1.9e-06
invasive ductal carcinoma 1.400 3.9e-03
non-small cell lung cancer 1.249 1.9e-16
ovarian cancer 1.700 1.6e-03
pancreatic cancer 1.600 4.9e-03
pancreatic carcinoma 1.600 4.9e-03
psoriasis 1.300 6.4e-12
tuberculosis and treatment for 3 months -1.200 2.0e-03
ulcerative colitis 1.200 2.5e-05

Synonym

Accession Q9Y3C6 O15001 Q5TDC9 PPIase
Symbols CYPL1
hCyPX
PPIase
CGI-124

Gene

PANTHER Protein Class (1)

PDB

5XJC   5MQF   1XWN   2K7N   2X7K  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (4)

AA Sequence

MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGT      1 - 70
GRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVN     71 - 140
RVGMVETNSQDRPVDDVKIIKAYPSG                                                141 - 166
//

Text Mined References (19)

PMID Year Title