Property Summary

NCBI Gene PubMed Count 17
PubMed Score 7.98
PubTator Score 59.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
gastric cancer 1.500 0.003
hepatocellular carcinoma 1.800 0.000
pancreatic cancer 1.600 0.005
tuberculosis and treatment for 6 months -1.500 0.000
non-small cell lung cancer 1.249 0.000
pancreatic carcinoma 1.600 0.005
psoriasis 1.300 0.000
ductal carcinoma in situ 1.100 0.000
invasive ductal carcinoma 1.400 0.004
ulcerative colitis 1.200 0.000
ovarian cancer 1.700 0.002
Breast cancer 1.200 0.000

Synonym

Accession Q9Y3C6 O15001 Q5TDC9 PPIase
Symbols CYPL1
hCyPX
PPIase
CGI-124

Gene

PANTHER Protein Class (1)

PDB

1XWN   2K7N   2X7K  

Gene RIF (4)

PMID Text
20368803 molecular model for the binding mode of SKIP to PPIL1 which emphasizes the versatility of cyclophilin-type PPIases to engage in additional interactions with other proteins apart from active site contacts despite their limited surface area.
20007319 The large disordered region in SKIP provides an interaction platform. Its disorder-order transition, induced by PPIL1 binding, may adapt the requirement for a large structural rearrangement occurred in the activation of spliceosome
16595688 here the solution structure of PPIL1 determined by NMR spectroscopy
15772761 NMR protein structure of PPIL1

AA Sequence

MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGT      1 - 70
GRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVN     71 - 140
RVGMVETNSQDRPVDDVKIIKAYPSG                                                141 - 166
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21269460 2011 Initial characterization of the human central proteome.
20368803 2010 The crystal structure of PPIL1 bound to cyclosporine A suggests a binding mode for a linear epitope of the SKIP protein.
20007319 2010 A large intrinsically disordered region in SKIP and its disorder-order transition induced by PPIL1 binding revealed by NMR.
16595688 2006 Solution structure of human peptidyl prolyl isomerase-like protein 1 and insights into its interaction with SKIP.
15772761 2005 Backbone and side chain assignments of human Peptidylprolyl Isomerase Like 1 (hPPIL1).
More...