Property Summary

NCBI Gene PubMed Count 34
PubMed Score 23.43
PubTator Score 19.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma -1.300 1.4e-02
atypical teratoid / rhabdoid tumor -1.200 5.9e-05
glioblastoma -1.500 6.6e-03
medulloblastoma -1.100 1.7e-06
medulloblastoma, large-cell -1.500 1.2e-03
Multiple myeloma 1.592 3.8e-03
ovarian cancer -1.800 2.0e-06
pancreatic ductal adenocarcinoma liver m... -1.044 2.0e-02
spina bifida -1.409 3.7e-02

Gene RIF (16)

AA Sequence

MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRI      1 - 70
AQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCM     71 - 140
EPVDAALLSSYETN                                                            141 - 154
//

Text Mined References (39)

PMID Year Title