Property Summary

NCBI Gene PubMed Count 32
Grant Count 10
R01 Count 5
Funding $858,697.33
PubMed Score 22.13
PubTator Score 19.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.592 0.004
astrocytoma -1.300 0.014
glioblastoma -1.500 0.007
atypical teratoid / rhabdoid tumor -1.300 0.000
medulloblastoma -1.100 0.000
medulloblastoma, large-cell -1.700 0.000
pancreatic ductal adenocarcinoma liver m... -1.044 0.020
spina bifida -1.409 0.037
ovarian cancer -1.800 0.000

Gene RIF (14)

PMID Text
25195858 RNF11 is at the center of a finally regulated system where it acts both as an adaptor and a modulator of itch-mediated control of ubiquitination events underlying membrane traffic.
23669642 Our data exemplifies the relevance of RNF11 and persistent NF-kappaB activation in Parkinson's disease
23308279 RNF11 functions together with TAX1BP1 to restrict antiviral signaling and IFN-beta production.
23222715 The negative influence that perturbation of RNF11 and SARA levels exerts on the lysosomal degradation of EGFRs could underscore the significance of overexpression of RNF11 in certain cancers.
22975135 Microglial RNF11 is a negative regulator of NF-kappaB signalling pathway and could be a strong potential target for modulating inflammatory responses in neurodegenerative diseases.
22507528 RNF11 negatively regulates canonical NF-kappaB signaling in the nervous system.
20676133 Data show that membrane anchoring through acylation is necessary for RNF11 to be post-translationally modified by the addition of several ubiquitin moieties.
19131965 RNF11, together with TAX1BP1 and Itch, is an essential component of an A20 ubiquitin-editing protein complex that ensures transient activation of inflammatory signalling pathways.
18724389 WWP1 may promote cell proliferation and survival partially through suppressing RNF11-mediated ErbB2 and EGFR downregulation in human cancer cells.
18615712 Analysis reveals that the main determinants of selectivity between ubiquitin ligases RNF11 and E2 ubiquitin-conjugating enzymes resides on ring domains, rather than on the E2s.
More...

AA Sequence

MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRI      1 - 70
AQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCM     71 - 140
EPVDAALLSSYETN                                                            141 - 154
//

Text Mined References (37)

PMID Year Title
25195858 2015 RNF11 is a GGA protein cargo and acts as a molecular adaptor for GGA3 ubiquitination mediated by Itch.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24105792 2014 Protein microarray characterization of the S-nitrosoproteome.
23669642 2013 NF-?B activity is inversely correlated to RNF11 expression in Parkinson's disease.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23308279 2013 RING finger protein 11 targets TBK1/IKKi kinases to inhibit antiviral signaling.
23222715 2013 SARA and RNF11 interact with each other and ESCRT-0 core proteins and regulate degradative EGFR trafficking.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22975135 2012 RNF11 modulates microglia activation through NF-?B signalling cascade.
22507528 2012 Neuronal RING finger protein 11 (RNF11) regulates canonical NF-?B signaling.
More...