Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.60
PubTator Score 4.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.100 1.2e-02
colon cancer 1.600 2.3e-04
ependymoma -1.100 3.7e-02
invasive ductal carcinoma -1.059 2.2e-02
lung cancer 2.500 2.8e-04
nasopharyngeal carcinoma 1.100 6.3e-04
non primary Sjogren syndrome sicca 1.100 1.2e-02
ovarian cancer 1.300 1.2e-04

Gene RIF (2)

AA Sequence

MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRK      1 - 70
RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNY     71 - 140
YQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE                                    141 - 178
//

Text Mined References (20)

PMID Year Title