Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.15
PubTator Score 4.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.100 0.012
ependymoma -1.100 0.037
lung cancer 2.500 0.000
colon cancer 1.600 0.000
non primary Sjogren syndrome sicca 1.100 0.012
invasive ductal carcinoma -1.059 0.022
nasopharyngeal carcinoma 1.100 0.001
ovarian cancer 1.300 0.000

Gene RIF (2)

PMID Text
24425784 RNA 3'-phosphate cyclase (RTCD1/RTCA) interacted with HSPC111, and RTCD1 was involved in the HSPC111 multiprotein complex in regulating rRNA production and ribosomal biogenesis.
18373870 HSPC111 is an estrogen and c-Myc target gene that is over-expressed in breast cancer and is associated with an adverse patient outcome.

AA Sequence

MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRK      1 - 70
RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNY     71 - 140
YQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE                                    141 - 178
//

Text Mined References (19)

PMID Year Title
24425784 2014 HSPC111 governs breast cancer growth by regulating ribosomal biogenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18373870 2008 The estrogen and c-Myc target gene HSPC111 is over-expressed in breast cancer and associated with poor patient outcome.
More...