Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.42
PubTator Score 0.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 8.38165195154968E-10
intraductal papillary-mucinous neoplasm (IPMN) 3289 7.12949349027394E-4
medulloblastoma, large-cell 6234 7.92310206889326E-4
diabetes mellitus 1663 0.0067195006814135
hereditary spastic paraplegia 313 0.00729570967221524
subependymal giant cell astrocytoma 2287 0.0349542943210491
Disease Target Count Z-score Confidence
Wiskott-Aldrich syndrome 27 3.56 1.8
Paraplegia 71 3.09 1.5

Expression

  Differential Expression (6)

Synonym

Accession Q9Y3C0 B2RC74 Q53FF0 Q6IAI4 Q96QK0
Symbols CCDC53
CGI-116

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
C. elegans OMA EggNOG Inparanoid
Fruitfly OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
22082156 Knockdown of coiled-coil domain containing 53 (CCDC53) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N

AA Sequence

MDEDGLPLMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSTVCEEKLADLSLRIQQIETTLNILD      1 - 70
AKLSSIPGLDDVTVEVSPLNVTSVTNGAHPEATSEQPQQNSTQDSGLQESEVSAENILTVAKDPRYARYL     71 - 140
KMVQVGVPVMAIRNKMISEGLDPDLLERPDAPVPDGESEKTVEESSDSESSFSD                    141 - 194
//

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20498093 2010 WASH and WAVE actin regulators of the Wiskott-Aldrich syndrome protein (WASP) family are controlled by analogous structurally related complexes.
19922875 2009 The Arp2/3 activator WASH controls the fission of endosomes through a large multiprotein complex.
19060904 2009 An empirical framework for binary interactome mapping.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...