Property Summary

NCBI Gene PubMed Count 13
Grant Count 5
R01 Count 5
Funding $289,809.34
PubMed Score 0.42
PubTator Score 0.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Gene RIF (1)

PMID Text
22082156 Knockdown of coiled-coil domain containing 53 (CCDC53) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N

AA Sequence

MDEDGLPLMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSTVCEEKLADLSLRIQQIETTLNILD      1 - 70
AKLSSIPGLDDVTVEVSPLNVTSVTNGAHPEATSEQPQQNSTQDSGLQESEVSAENILTVAKDPRYARYL     71 - 140
KMVQVGVPVMAIRNKMISEGLDPDLLERPDAPVPDGESEKTVEESSDSESSFSD                    141 - 194
//

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20498093 2010 WASH and WAVE actin regulators of the Wiskott-Aldrich syndrome protein (WASP) family are controlled by analogous structurally related complexes.
19922875 2009 The Arp2/3 activator WASH controls the fission of endosomes through a large multiprotein complex.
19060904 2009 An empirical framework for binary interactome mapping.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...