Property Summary

NCBI Gene PubMed Count 19
Grant Count 4
R01 Count 1
Funding $215,868.67
PubMed Score 139.25
PubTator Score 165.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Multiple myeloma 1.594 0.001
osteosarcoma -1.068 0.000
glioblastoma 1.400 0.003
group 4 medulloblastoma -1.800 0.000
medulloblastoma, large-cell 1.100 0.000
non primary Sjogren syndrome sicca 1.400 0.013
subependymal giant cell astrocytoma 1.662 0.026
pulmonary arterial hypertension -2.000 0.039
spina bifida -1.310 0.042
acute myeloid leukemia -1.100 0.025
ovarian cancer -1.700 0.000
pituitary cancer -1.200 0.000
dermatomyositis 1.600 0.001

Synonym

Accession Q9Y3B8 B2R532 Q32Q18 Q53FT1 Q6FIC6 Q9UFY7
Symbols RFN
SFN
REX2
CGI-114

Gene

Gene RIF (6)

PMID Text
26147002 CBY1 downregulation in CML arises from reduced protein stability upon binding to 14-3-3sigma adapter protein. The ubiquitin proteasome system UPS participates in reducing stability of CBY1 bound with 14-3-3sigma through enhanced SUMOylation.
24102700 Loss of 14-3-3sigma sensitizes cells to UVB. After a transient cell cycle arrest, 14-3-3sigma-deficient cells die by undergoing mitotic catastrophe.
23741365 REXO2 is an oligoribonuclease active in human mitochondria and present both in cytosolic and mitochondrial fractions.
20877624 Observational study of gene-disease association. (HuGE Navigator)
18023590 The expression in E. coli of orn and homologues from Mycobacterium smegmatis and human, and large-scale purification of the three enzymes, is reported.
15362935 SFN expression is involved in resistance of RSa cells to UV-C-induced cell death through the roles it plays in the DNA repair process

AA Sequence

MLGGSLGSRLLRGVGGSHGRFGARGVREGGAAMAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDS      1 - 70
DLNILAEGPNLIIKQPDELLDSMSDWCKEHHGKSGLTKAVKESTITLQQAEYEFLSFVRQQTPPGLCPLA     71 - 140
GNSVHEDKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYEFAPKKAASHRALDDISESIKELQFY    141 - 210
RNNIFKKKIDEKKRKIIENGENEKTVS                                               211 - 237
//

Text Mined References (26)

PMID Year Title
26147002 2015 14-3-3 Binding and Sumoylation Concur to the Down-Modulation of ?-catenin Antagonist chibby 1 in Chronic Myeloid Leukemia.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24102700 2013 The epithelium specific cell cycle regulator 14-3-3sigma is required for preventing entry into mitosis following ultraviolet B.
23741365 2013 REXO2 is an oligoribonuclease active in human mitochondria.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
More...