Property Summary

NCBI Gene PubMed Count 20
PubMed Score 143.84
PubTator Score 165.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute myeloid leukemia -1.100 2.5e-02
dermatomyositis 1.600 6.9e-04
glioblastoma 1.400 3.1e-03
group 4 medulloblastoma -1.800 2.4e-06
medulloblastoma, large-cell 1.100 1.5e-04
Multiple myeloma 1.594 8.5e-04
non primary Sjogren syndrome sicca 1.400 1.3e-02
osteosarcoma -1.068 1.2e-04
ovarian cancer -1.700 1.1e-05
pituitary cancer -1.200 4.1e-05
pulmonary arterial hypertension -2.000 3.9e-02
spina bifida -1.310 4.2e-02
subependymal giant cell astrocytoma 1.662 2.6e-02

Gene RIF (7)

AA Sequence

MLGGSLGSRLLRGVGGSHGRFGARGVREGGAAMAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDS      1 - 70
DLNILAEGPNLIIKQPDELLDSMSDWCKEHHGKSGLTKAVKESTITLQQAEYEFLSFVRQQTPPGLCPLA     71 - 140
GNSVHEDKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYEFAPKKAASHRALDDISESIKELQFY    141 - 210
RNNIFKKKIDEKKRKIIENGENEKTVS                                               211 - 237
//

Text Mined References (27)

PMID Year Title