Property Summary

NCBI Gene PubMed Count 19
PubMed Score 3.41
PubTator Score 3.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
malignant mesothelioma 3232 9.3e-06
lung cancer 4740 4.2e-05
ovarian cancer 8520 1.8e-04
group 3 medulloblastoma 4104 2.4e-03

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.300 2.4e-03
lung cancer 1.600 4.2e-05
malignant mesothelioma 1.300 9.3e-06
ovarian cancer 1.300 1.8e-04

Gene RIF (1)

AA Sequence

MSKLGRAARGLRKPEVGGVIRAIVRAGLAMPGPPLGPVLGQRGVSINQFCKEFNERTKDIKEGIPLPTKI      1 - 70
LVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSV     71 - 140
VRSIIGSARSLGIRVVKDLSSEELAAFQKERAIFLAAQKEADLAAQEEAAKK                      141 - 192
//

Text Mined References (23)

PMID Year Title