Property Summary

NCBI Gene PubMed Count 19
PubMed Score 3.41
PubTator Score 3.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
lung cancer 1.600 0.000
sonic hedgehog group medulloblastoma 1.400 0.000
ovarian cancer 1.300 0.000

Synonym

Accession Q9Y3B7 A6NLT0 A8K219 Q32P46 Q96Q73 L11mt
Symbols L11MT
CGI-113
MRP-L11

Gene

PDB

3J9M   3J7Y  

Gene RIF (2)

PMID Text
22190034 HIV-1 Rev is identified to have a physical interaction with mitochondrial ribosomal protein L11 (MRPL11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22190034 HIV-1 Rev is identified to have a physical interaction with mitochondrial ribosomal protein L11 (MRPL11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MSKLGRAARGLRKPEVGGVIRAIVRAGLAMPGPPLGPVLGQRGVSINQFCKEFNERTKDIKEGIPLPTKI      1 - 70
LVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSV     71 - 140
VRSIIGSARSLGIRVVKDLSSEELAAFQKERAIFLAAQKEADLAAQEEAAKK                      141 - 192
//

Text Mined References (22)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22190034 2011 Global landscape of HIV-human protein complexes.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21453772 2011 Purification of human mitochondrial ribosomal L7/L12 stalk proteins and reconstitution of functional hybrid ribosomes in Escherichia coli.
21269460 2011 Initial characterization of the human central proteome.
More...