Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Breast cancer 3578 9.6e-15
osteosarcoma 7950 1.3e-05
ovarian cancer 8520 4.6e-05
lung cancer 4740 1.4e-02

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer 1.100 9.6e-15
lung cancer 1.100 1.4e-02
osteosarcoma -1.311 1.3e-05
ovarian cancer 1.200 4.6e-05

Synonym

Accession Q9Y3B6 D3DS60 Q9BUM3
Symbols CGI-112
FAM158A
C14orf122

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MGEVEISALAYVKMCLHAARYPHAAVNGLFLAPAPRSGECLCLTDCVPLFHSHLALSVMLEVALNQVDVW      1 - 70
GAQAGLVVAGYYHANAAVNDQSPGPLALKIAGRIAEFFPDAVLIMLDNQKLVPQPRVPPVIVLENQGLRW     71 - 140
VPKDKNLVMWRDWEESRQMVGALLEDRAHQHLVDFDCHLDDIRQDWTNQRLNTQITQWVGPTNGNGNA      141 - 208
//

Text Mined References (7)

PMID Year Title