Property Summary

NCBI Gene PubMed Count 19
PubMed Score 3.54
PubTator Score 4.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.200 0.002
ovarian cancer 1.400 0.002
Breast cancer 1.100 0.000

Synonym

Accession Q9Y3B4 Q53TM1
Symbols P14
Ht006
SAP14
SAP14a
SF3B14
CGI-110
HSPC175
SF3B14a

Gene

PDB

2F9D   2F9J   2FHO   3LQV  

Gene RIF (4)

PMID Text
26784522 the p14-RNA interaction screens charges on the backbone of the branch site during spliceosome assembly.
19773279 Observational study of gene-disease association. (HuGE Navigator)
16432215 determined the high resolution structure of a complex between SF3b14 and a peptide derived from SF3b155 and proposed a model for recognition of the pre-mRNA branch sequence adenosine.
12738865 determined the three-dimensional structure of the human SF3b complex by single-particle electron cryomicroscopy at a resolution of less than 10 angstroms, allowing identification of protein domains with known structural folds

AA Sequence

MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDA      1 - 70
KNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK                    71 - 125
//

Text Mined References (26)

PMID Year Title
26784522 2016 Interaction between the Spliceosomal Pre-mRNA Branch Site and U2 snRNP Protein p14.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
21062891 2011 Structural model of the p14/SF3b155 · branch duplex complex.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
More...