Property Summary

NCBI Gene PubMed Count 19
PubMed Score 4.59
PubTator Score 4.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Breast cancer 3578 9.8e-06
group 3 medulloblastoma 4104 2.1e-03
ovarian cancer 8520 2.1e-03

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer 1.100 9.8e-06
group 3 medulloblastoma 1.200 2.1e-03
ovarian cancer 1.400 2.1e-03

 GO Function (1)

Gene RIF (4)

AA Sequence

MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDA      1 - 70
KNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK                    71 - 125
//

Text Mined References (29)

PMID Year Title