Property Summary

NCBI Gene PubMed Count 14
Grant Count 77
R01 Count 45
Funding $9,184,661.47
PubMed Score 2.14
PubTator Score 14.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.331 0.001
osteosarcoma 1.800 0.001
posterior fossa group B ependymoma 1.200 0.000
glioblastoma 1.100 0.000
pancreatic ductal adenocarcinoma liver m... -1.088 0.004
active Crohn's disease 1.173 0.010
pediatric high grade glioma 1.200 0.002
pilocytic astrocytoma 1.400 0.000
ovarian cancer -1.200 0.005

Synonym

Accession Q9Y3B3 Q8NBU8 Q8WUU6 Q96K51
Symbols p27
p24g3
CGI-109
p24gamma3

Gene

Gene RIF (3)

PMID Text
25074978 TMED7 is required to initiate and mediate the delivery of TLR4 to the plasma membrane
22426228 TMED7 is essential for TAG-mediated disruption of the TRAM/TRIF complex and the degradation of toll-like receptor 4
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MPRPGSAQRWAAVAGRWGCRLLALLLLVPGPGGASEITFELPDNAKQCFYEDIAQGTKCTLEFQVITGGH      1 - 70
YDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHKTVYFDFQVGEDPPLFPSENR     71 - 140
VSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAYWSVGEALILLVVSIGQVFLLKS    141 - 210
FFSDKRTTTTRVGS                                                            211 - 224
//

Text Mined References (16)

PMID Year Title
25074978 2014 The COP II adaptor protein TMED7 is required to initiate and mediate the delivery of TLR4 to the plasma membrane.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22426228 2012 The GOLD domain-containing protein TMED7 inhibits TLR4 signalling from the endosome upon LPS stimulation.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16940185 2006 Coatomer, the coat protein of COPI transport vesicles, discriminates endoplasmic reticulum residents from p24 proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
More...