Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.67
PubTator Score 6.48

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9Y3A6 B1AKT4 B2R703 D3DT38 Q96AX8
Symbols p28
p24g2
CGI-100

Gene

Gene RIF (2)

PMID Text
24778190 The luminal alpha-helical but not GOLD domain of p24gamma2 was required for efficient GPI-AP transport.
18549622 Expression of cgi-100 mRNA decreased in a dose- and time-dependent manner in the K562 cells treated with matrine and over-expression of cgi-100 elevates the proliferation and the immaturity level of K562 cells.

AA Sequence

MGDKIWLPFPVLLLAALPPVLLPGAAGFTPSLDSDFTFTLPAGQKECFYQPMPLKASLEIEYQVLDGAGL      1 - 70
DIDFHLASPEGKTLVFEQRKSDGVHTVETEVGDYMFCFDNTFSTISEKVIFFELILDNMGEQAQEQEDWK     71 - 140
KYITGTDILDMKLEDILESINSIKSRLSKSGHIQTLLRAFEARDRNIQESNFDRVNFWSMVNLVVMVVVS    141 - 210
AIQVYMLKSLFEDKRKSRT                                                       211 - 229
//

Text Mined References (16)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24778190 2014 The ?-helical region in p24?2 subunit of p24 protein cargo receptor is pivotal for the recognition and transport of glycosylphosphatidylinositol-anchored proteins.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
21269460 2011 Initial characterization of the human central proteome.
19948005 2010 p28, a novel ERGIC/cis Golgi protein, required for Golgi ribbon formation.
18549622 2008 [Effects of matrine on cgi-100 gene expression and proliferation in K562 cells].
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...