Property Summary

NCBI Gene PubMed Count 60
PubMed Score 174.41
PubTator Score 117.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Anemia, Aplastic 7 0.0 0.0
Shwachman syndrome 1 0.0 0.0
Disease Target Count
Exocrine pancreatic insufficiency 32
Anemia 365
MYELODYSPLASTIC SYNDROME 53
Abnormality of the metaphyses 48
Aplastic anemia, idiopathic 4
Autosomal recessive predisposition 1442
Bullet vertebral body 17
Cognitive delay 608
Decreased platelet count 111
Delayed bone age 136
Dull intelligence 645
Eczema 45
Elevated hepatic transaminases 81
Enlargement of the costochondral junction 4
Failure to gain weight 365
Foetal haemoglobin increased 7
Generalized hypotonia 37
Generalized osteopenia 99
Global developmental delay 608
Hemoglobin low 124
Hepatic enzyme increased 81
Hepatomegaly 285
Hip joint varus deformity - observation 24
Hypoplastic myelodysplasia 18
Ichthyoses 41
Increased calcium level in kidney 21
Intellectual disability 1016
Irregular ossification at anterior rib ends 1
Leukemia, Myelocytic, Acute 120
Liver Dysfunction 99
Liver enzymes abnormal 81
Liver function test increased 81
Liver function tests abnormal finding 81
Low Birth Weights 69
Low intelligence 645
Malabsorption 82
Mental Retardation 645
Mental and motor retardation 608
Mental deficiency 645
Metaphyseal chondrodysplasia 7
Metaphyseal sclerosis 3
Metaphyseal widening 22
Mild Mental Retardation 70
Myocardial necrosis 2
Narrow sacroiliac notch 4
Narrow thorax 53
Nephrocalcinosis 35
Neutrophil count decreased 47
Osteopenia 99
Ovoid vertebral bodies 17
Pancreatic Insufficiency 13
Pancytopenia 45
Pediatric failure to thrive 365
Poor school performance 645
Recurrent infections 48
Respiratory Distress Syndrome 15
Short stature 531
Slipped Capital Femoral Epiphyses 3
Small for gestational age (disorder) 69
Specific learning disability 47
Steatorrhea 34
Subclinical abnormal liver function tests 81
Thrombocytopenia 197
Transaminases increased 81
Disease Target Count P-value
lung adenocarcinoma 2716 6.9e-23
acute myeloid leukemia 783 9.0e-03
Disease Target Count Z-score Confidence
Neutropenia 72 4.121 2.1
Metaphyseal dysplasia 11 3.656 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
acute myeloid leukemia 1.100 9.0e-03
lung adenocarcinoma -1.100 6.9e-23

Gene RIF (43)

AA Sequence

MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKED      1 - 70
LISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDI     71 - 140
HYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVC    141 - 210
LIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE                                  211 - 250
//

Text Mined References (64)

PMID Year Title