Property Summary

NCBI Gene PubMed Count 21
PubMed Score 24.24
PubTator Score 6.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
astrocytoma -1.300 0.004
tuberculosis and treatment for 6 months 1.200 0.000

Synonym

Accession Q9Y3A3 B4DML0 Q53SE0 Q7Z4Y6 Q9H2P3 Q9H5J1 Q9Y4T8
Symbols 2C4D
MOB1
MOB3
PHOCN
PREI3
CGI-95
MOBKL3

Gene

Gene RIF (2)

PMID Text
24872389 hMOB3 modulates MST1 apoptotic signaling and supports tumor growth in glioblastoma multiforme.
18362890 phosphorylation of MOB1 at Thr74 by MST2 is essential to make a complex of MOB1, MST2 and NDR1, and to fully activate NDR1

AA Sequence

MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWK      1 - 70
YEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNK     71 - 140
YFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPI    141 - 210
LEEEVQNSVSGESEA                                                           211 - 225
//

Text Mined References (24)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
24872389 2014 hMOB3 modulates MST1 apoptotic signaling and supports tumor growth in glioblastoma multiforme.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
19156129 2009 An integrated workflow for charting the human interaction proteome: insights into the PP2A system.
18782753 2009 A PP2A phosphatase high density interaction network identifies a novel striatin-interacting phosphatase and kinase complex linked to the cerebral cavernous malformation 3 (CCM3) protein.
18362890 2008 Threonine 74 of MOB1 is a putative key phosphorylation site by MST2 to form the scaffold to activate nuclear Dbf2-related kinase 1.
More...