Property Summary

NCBI Gene PubMed Count 22
PubMed Score 24.73
PubTator Score 6.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (2)

Disease log2 FC p
astrocytoma -1.300 3.5e-03
tuberculosis and treatment for 6 months 1.200 4.6e-06

Gene RIF (2)

AA Sequence

MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWK      1 - 70
YEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNK     71 - 140
YFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPI    141 - 210
LEEEVQNSVSGESEA                                                           211 - 225
//

Text Mined References (25)

PMID Year Title