Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.38
PubTator Score 3.05

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (1)

AA Sequence

MAAAFRKAAKSRQREHRERSQPGFRKHLGLLEKKKDYKLRADDYRKKQEYLKALRKKALEKNPDEFYYKM      1 - 70
TRVKLQDGVHIIKETKEEVTPEQLKLMRTQDVKYIEMKRVAEAKKIERLKSELHLLDFQGKQQNKHVFFF     71 - 140
DTKKEVEQFDVATHLQTAPELVDRVFNRPRIETLQKEKVKGVTNQTGLKRIAKERQKQYNCLTQRIEREK    141 - 210
KLFVIAQKIQTRKDLMDKTQKVKVKKETVNSPAIYKFQSRRKR                               211 - 253
//

Text Mined References (20)

PMID Year Title