Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.52
PubTator Score 0.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Brain glioma 7 3.786 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.052 2.3e-02
ovarian cancer 1.800 1.8e-05
pancreatic ductal adenocarcinoma liver m... -1.180 3.0e-02

Gene RIF (1)

AA Sequence

MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIRESEDSTDFNDKILNEPLKHS      1 - 70
DFFNVKELFSVRSLFDARVHLGHKAGCRHRFMEPYIFGSRLDHDIIDLEQTATHLQLALNFTAHMAYRKG     71 - 140
IILFISRNRQFSYLIENMARDCGEYAHTRYFRGGMLTNARLLFGPTVRLPDLIIFLHTLNNIFEPHVAVR    141 - 210
DAAKMNIPTVGIVDTNCNPCLITYPVPGNDDSPLAVHLYCRLFQTAITRAKEKRQQVEALYRLQGQKEPG    211 - 280
DQGPAHPPGADMSHSL                                                          281 - 296
//

Text Mined References (13)

PMID Year Title