Property Summary

NCBI Gene PubMed Count 24
PubMed Score 12.72
PubTator Score 10.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
MENTAL RETARDATION, X-LINKED, SYNDROMIC, RAYMOND TYPE 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Benign epilepsy with centrotemporal spikes 13 3.694 1.8

Expression

  Differential Expression (13)

Disease log2 FC p
Atopic dermatitis -1.300 1.4e-06
Breast cancer 1.100 1.4e-12
ependymoma -1.300 2.4e-02
group 4 medulloblastoma -1.300 9.1e-04
intraductal papillary-mucinous adenoma (... 1.100 3.0e-03
intraductal papillary-mucinous carcinoma... 1.200 3.9e-03
intraductal papillary-mucinous neoplasm ... 1.600 8.5e-03
lung adenocarcinoma 1.400 1.1e-06
osteosarcoma 1.911 4.1e-03
ovarian cancer 1.500 3.0e-05
Pick disease -1.100 1.2e-03
sarcoidosis -1.100 3.9e-02
subependymal giant cell astrocytoma -2.503 1.1e-02

Gene RIF (9)

AA Sequence

MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLILGTCTLFFAFECRYLAVQLSPAIPV      1 - 70
FAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKY     71 - 140
CYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYVFAFNIVYVALKS    141 - 210
LKIGFLETLKETPGTVLEVLICFFTLWSVVGLTGFHTFLVALNQTTNEDIKGSWTGKNRVQNPYSHGNIV    211 - 280
KNCCEVLCGPLPPSVLDRRGILPLEESGSRPPSTQETSSSLLPQSPAPTEHLNSNEMPEDSSTPEEMPPP    281 - 350
EPPEPPQEAAEAEK                                                            351 - 364
//

Text Mined References (26)

PMID Year Title