Property Summary

NCBI Gene PubMed Count 21
Grant Count 3
R01 Count 3
Funding $577,500
PubMed Score 10.02
PubTator Score 10.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Synonym

Accession Q9Y397 B4F6G2 D3DTF9 Q59EK4 Q5JSW5 Q8WWS7 Q9BPY4 Q9NSP0 Q9NVL0 Q9NVR6
Symbols CGI89
DHHC9
MMSA1
MRXSZ
ZNF379
ZNF380
CXorf11
ZDHHC10

Gene

Gene RIF (7)

PMID Text
26358559 ZDHHC9 gene mutation is associated with Lujan-Fryns syndrome.
24811172 Two missense mutation, R148W and P150S,of zDHHC9, affecting the autopalmitoylation is associated with the X-linked intellectual disability.
24248599 Data indicate that sp-Erf2/zDHHC9 palmitoylates Ras proteins in a highly selective manner in the trans-Golgi compartment to facilitate PM targeting via the trans-Golgi network, a role that is most certainly critical for Ras-driven tumorigenesis.
22230506 MMSA-1 may play a pivotal role in multiple myeloma proliferation and osteolysis destruction.
21388813 Studies indicate that mutations in DHHC9 were associated with X-linked mental retardation.
17519897 DHHC9 is a gastrointestinal-related protein highly expressed in microsatellite stable colorectal cancers.
16000296 Data show that H- and N-Ras are palmitoylated by a human protein palmitoyltransferase encoded by the ZDHHC9 and GCP16 genes.

AA Sequence

MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLILGTCTLFFAFECRYLAVQLSPAIPV      1 - 70
FAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKY     71 - 140
CYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYVFAFNIVYVALKS    141 - 210
LKIGFLETLKETPGTVLEVLICFFTLWSVVGLTGFHTFLVALNQTTNEDIKGSWTGKNRVQNPYSHGNIV    211 - 280
KNCCEVLCGPLPPSVLDRRGILPLEESGSRPPSTQETSSSLLPQSPAPTEHLNSNEMPEDSSTPEEMPPP    281 - 350
EPPEPPQEAAEAEK                                                            351 - 364
//

Text Mined References (23)

PMID Year Title
26358559 2016 Tentative clinical diagnosis of Lujan-Fryns syndrome--A conglomeration of different genetic entities?
24811172 2014 Mutations in the X-linked intellectual disability gene, zDHHC9, alter autopalmitoylation activity by distinct mechanisms.
24248599 2014 Regulation of Ras localization and cell transformation by evolutionarily conserved palmitoyltransferases.
23034182 2012 Analysis of substrate specificity of human DHHC protein acyltransferases using a yeast expression system.
22230506 2012 [The research on the expression and localization of multiple myeloma associated antigen MMSA-1].
21388813 2011 DHHC palmitoyl transferases: substrate interactions and (patho)physiology.
19377476 2009 A systematic, large-scale resequencing screen of X-chromosome coding exons in mental retardation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17519897 2007 Differential expression of DHHC9 in microsatellite stable and instable human colorectal cancer subgroups.
More...