Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.16
PubTator Score 4.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.385 0.001
malignant mesothelioma -2.600 0.000
osteosarcoma -1.105 0.002
glioblastoma 1.200 0.009
pancreatic ductal adenocarcinoma liver m... -2.087 0.002
diabetes mellitus -1.400 0.004
pilocytic astrocytoma 1.100 0.000
gastric carcinoma -1.700 0.011
ovarian cancer -2.500 0.000

Synonym

Accession Q9Y394 B2R896 Q9UKU2
Symbols CGI-86
SDR34C1
retDSR4
retSDR4

Gene

PANTHER Protein Class (2)

 GO Function (1)

 GO Component (1)

 Compartment GO Term (2)

Gene RIF (3)

PMID Text
26466768 DHRS7 participates in the reductive metabolism of steroids and retinoids.Expression patterns of DHRS7 at the mRNA as well as protein level were determined in a panel of various human tissue samples.
24316191 DHRS7 containing TEV-cleavable His10 and FLAG-tag was cloned and expressed in the Sf9 cell line.
24246760 DHRS7 is another enzyme from SDR superfamily that have been proved, at least in vitro, to contribute to the metabolism of xenobiotics with carbonyl group.

AA Sequence

MNWELLLWLLVLCALLLLLVQLLRFLRADGDLTLLWAEWQGRRPEWELTDMVVWVTGASSGIGEELAYQL      1 - 70
SKLGVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGG     71 - 140
MSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERKQGKIVTVNSILGIISVPLSIGYCASKHAL    141 - 210
RGFFNGLRTELATYPGIIVSNICPGPVQSNIVENSLAGEVTKTIGNNGDQSHKMTTSRCVRLMLISMAND    211 - 280
LKEVWISEQPFLLVTYLWQYMPTWAWWITNKMGKKRIENFKSGVDADSSYFKIFKTKHD               281 - 339
//

Text Mined References (16)

PMID Year Title
26466768 2016 Human DHRS7, promising enzyme in metabolism of steroids and retinoids?
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24316191 2014 Purification and reconstitution of human membrane-bound DHRS7 (SDR34C1) from Sf9 cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24246760 2014 Biochemical properties of human dehydrogenase/reductase (SDR family) member 7.
22036096 2011 A genome-wide meta-analysis of genetic variants associated with allergic rhinitis and grass sensitization and their interaction with birth order.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...