Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.19
PubTator Score 4.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 9.5e-07
diabetes mellitus -1.400 3.8e-03
gastric carcinoma -1.700 1.1e-02
glioblastoma 1.200 8.6e-03
malignant mesothelioma -2.600 7.2e-08
Multiple myeloma 1.385 7.0e-04
osteosarcoma -1.105 2.0e-03
ovarian cancer -2.500 3.0e-10
pancreatic ductal adenocarcinoma liver m... -2.087 2.0e-03

Synonym

Accession Q9Y394 B2R896 Q9UKU2
Symbols CGI-86
SDR34C1
retDSR4
retSDR4

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

 GO Function (1)

 GO Component (1)

Gene RIF (4)

AA Sequence

MNWELLLWLLVLCALLLLLVQLLRFLRADGDLTLLWAEWQGRRPEWELTDMVVWVTGASSGIGEELAYQL      1 - 70
SKLGVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGG     71 - 140
MSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERKQGKIVTVNSILGIISVPLSIGYCASKHAL    141 - 210
RGFFNGLRTELATYPGIIVSNICPGPVQSNIVENSLAGEVTKTIGNNGDQSHKMTTSRCVRLMLISMAND    211 - 280
LKEVWISEQPFLLVTYLWQYMPTWAWWITNKMGKKRIENFKSGVDADSSYFKIFKTKHD               281 - 339
//

Text Mined References (17)

PMID Year Title