Property Summary

NCBI Gene PubMed Count 8
PubMed Score 11.96
PubTator Score 3.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Sertoli cell-only syndrome 37 3.59 1.8

Expression

Synonym

Accession Q9Y388 A8K9Z0 Q5JY82 Q9Y3I8
Symbols Snu17
CGI-79

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MNPLTKVKLINELNEREVQLGVADKVSWHSEYKDSAWIFLGGLPYELTEGDIICVFSQYGEIVNINLVRD      1 - 70
KKTGKSKGFCFLCYEDQRSTILAVDNFNGIKIKGRTIRVDHVSNYRAPKDSEEIDDVTRQLQEKGCGART     71 - 140
PSPSLSESSEDEKPTKKHKKDKKEKKKKKKEKEKADREVQAEQPSSSSPRRKTVKEKDDTGPKKHSSKNS    141 - 210
ERAQKSEPREGQKLPKSRTAYSGGAEDLERELKKEKPKHEHKSSSRREAREEKTRIRDRGRSSDAHSSWY    211 - 280
NGRSEGRSYRSRSRSRDKSHRHKRARRSRERESSNPSDRWRH                                281 - 322
//

Text Mined References (16)

PMID Year Title