Property Summary

NCBI Gene PubMed Count 17
PubMed Score 12.82
PubTator Score 13.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
active Crohn's disease 1.061 3.2e-02
adult high grade glioma -1.200 6.3e-05
Astrocytoma, Pilocytic 1.400 1.7e-06
atypical teratoid / rhabdoid tumor -1.100 1.0e-03
Breast cancer 3.100 2.2e-02
dermatomyositis 1.300 5.0e-04
Down syndrome 1.200 1.0e-04
ependymoma 1.400 1.8e-10
glioblastoma 1.500 1.8e-08
group 3 medulloblastoma 1.300 7.9e-05
interstitial cystitis 1.500 7.2e-03
intraductal papillary-mucinous neoplasm ... -1.100 2.2e-02
medulloblastoma, large-cell 1.300 1.2e-03
Multiple myeloma 1.304 3.8e-02
nephrosclerosis 1.109 1.1e-03
osteosarcoma -2.068 1.3e-07
ovarian cancer -1.500 4.8e-05
pancreatic cancer -1.100 3.5e-03
pancreatic ductal adenocarcinoma liver m... -1.054 4.6e-02
primary Sjogren syndrome 1.200 1.7e-05
primitive neuroectodermal tumor 1.100 9.7e-05
psoriasis -1.200 2.7e-04
Rheumatoid arthritis 2.000 3.6e-02
tuberculosis and treatment for 6 months 1.300 3.7e-05
ulcerative colitis 1.100 5.0e-05

Protein-protein Interaction (1)

Gene RIF (4)

AA Sequence

METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPM      1 - 70
KPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGFMPTKGEGAIGSLDYTPEERRAL     71 - 140
AKKSQDFCCEGCGSAMKDVLLPLKSGSDSSQADQEAKELARQISFKAEVNSSGKTISESDLNHSFSLTDL    141 - 210
QDDIPTTFQGATASTSYGLQNSSAASFHQPTQPVAKNTSMSPRQRRAQQQSQRRLSTSPDVIQGHQPRDN    211 - 280
HTDHGGSAVLIVILTLALAALIFRRIYLANEYIFDFEL                                    281 - 318
//

Text Mined References (25)

PMID Year Title