Property Summary

NCBI Gene PubMed Count 16
Grant Count 25
R01 Count 16
Funding $2,393,743.14
PubMed Score 11.88
PubTator Score 13.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Gene RIF (3)

PMID Text
21245296 data support a physiological role for HRD1 and UBE2J1 in the homeostatic regulation of MHC class I assembly and expression
20222955 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
16720581 Ubc6e is phosphorylated in response to endoplasmic reticulum stress

AA Sequence

METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPM      1 - 70
KPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGFMPTKGEGAIGSLDYTPEERRAL     71 - 140
AKKSQDFCCEGCGSAMKDVLLPLKSGSDSSQADQEAKELARQISFKAEVNSSGKTISESDLNHSFSLTDL    141 - 210
QDDIPTTFQGATASTSYGLQNSSAASFHQPTQPVAKNTSMSPRQRRAQQQSQRRLSTSPDVIQGHQPRDN    211 - 280
HTDHGGSAVLIVILTLALAALIFRRIYLANEYIFDFEL                                    281 - 318
//

Text Mined References (24)

PMID Year Title
25660456 2015 Identification of ERAD components essential for dislocation of the null Hong Kong variant of ?-1-antitrypsin (NHK).
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24019521 2013 RNF185 is a novel E3 ligase of endoplasmic reticulum-associated degradation (ERAD) that targets cystic fibrosis transmembrane conductance regulator (CFTR).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22607976 2012 STT3B-dependent posttranslational N-glycosylation as a surveillance system for secretory protein.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21245296 2011 HRD1 and UBE2J1 target misfolded MHC class I heavy chains for endoplasmic reticulum-associated degradation.
20222955 2010 A meta-analysis of genome-wide data from five European isolates reveals an association of COL22A1, SYT1, and GABRR2 with serum creatinine level.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...