Property Summary

NCBI Gene PubMed Count 16
PubMed Score 11.88
PubTator Score 13.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ependymoma 2514 5.55704334185592E-14
atypical teratoid / rhabdoid tumor 4369 2.17533716594337E-9
medulloblastoma 1524 1.16424754787083E-8
pediatric high grade glioma 2712 5.54024235219828E-8
osteosarcoma 7933 1.29275993660107E-7
glioblastoma 5572 1.98442549044547E-7
pilocytic astrocytoma 3086 3.84392618525891E-6
primary Sjogren syndrome 789 1.65604064804113E-5
ovarian cancer 8492 2.16778023318074E-5
primitive neuroectodermal tumor 3031 2.79024258645328E-5
medulloblastoma, large-cell 6234 3.15475960238142E-5
tuberculosis and treatment for 6 months 686 3.66832042351099E-5
ulcerative colitis 2087 5.02595948586969E-5
Down syndrome 548 1.01132194149152E-4
interstitial cystitis 2299 1.97229910482336E-4
psoriasis 6685 2.71756054864226E-4
dermatomyositis 967 4.97221922447468E-4
nephrosclerosis 329 0.00108779168044865
pancreatic cancer 2300 0.00350055344974906
primary pancreatic ductal adenocarcinoma 1271 0.00656514940063091
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00818382539448955
Breast cancer 3099 0.0215510499526643
active Crohn's disease 918 0.0317096976349205
Rheumatoid Arthritis 1171 0.0357881117263813
Multiple myeloma 1328 0.0376569663444212

Expression

  Differential Expression (25)

Synonym

Accession Q9Y385 A8K3F9 Q53F25 Q5W0N4 Q9BZ32 Q9NQL3 Q9NY66 Q9P011 Q9P0S0 Q9UF10
Symbols UBC6
UBC6E
Ubc6p
CGI-76
NCUBE1
HSPC153
HSPC205
NCUBE-1
HSU93243

Gene

  Ortholog (13)

Gene RIF (3)

PMID Text
21245296 data support a physiological role for HRD1 and UBE2J1 in the homeostatic regulation of MHC class I assembly and expression
20222955 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
16720581 Ubc6e is phosphorylated in response to endoplasmic reticulum stress

AA Sequence

METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPM      1 - 70
KPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGFMPTKGEGAIGSLDYTPEERRAL     71 - 140
AKKSQDFCCEGCGSAMKDVLLPLKSGSDSSQADQEAKELARQISFKAEVNSSGKTISESDLNHSFSLTDL    141 - 210
QDDIPTTFQGATASTSYGLQNSSAASFHQPTQPVAKNTSMSPRQRRAQQQSQRRLSTSPDVIQGHQPRDN    211 - 280
HTDHGGSAVLIVILTLALAALIFRRIYLANEYIFDFEL                                    281 - 318
//

Text Mined References (24)

PMID Year Title
25660456 2015 Identification of ERAD components essential for dislocation of the null Hong Kong variant of ?-1-antitrypsin (NHK).
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24019521 2013 RNF185 is a novel E3 ligase of endoplasmic reticulum-associated degradation (ERAD) that targets cystic fibrosis transmembrane conductance regulator (CFTR).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22607976 2012 STT3B-dependent posttranslational N-glycosylation as a surveillance system for secretory protein.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21245296 2011 HRD1 and UBE2J1 target misfolded MHC class I heavy chains for endoplasmic reticulum-associated degradation.
20222955 2010 A meta-analysis of genome-wide data from five European isolates reveals an association of COL22A1, SYT1, and GABRR2 with serum creatinine level.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...