Property Summary

NCBI Gene PubMed Count 30
Grant Count 24
R01 Count 22
Funding $1,598,687.56
PubMed Score 35.57
PubTator Score 16.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.173 0.005
osteosarcoma 1.799 0.002
atypical teratoid / rhabdoid tumor -1.200 0.000
medulloblastoma, large-cell -1.200 0.000
hereditary spastic paraplegia -1.337 0.010
group 4 medulloblastoma 1.200 0.033
ulcerative colitis -1.200 0.003
ovarian cancer -1.900 0.000

Gene RIF (7)

PMID Text
23296203 These data provide molecular understanding of the mechanism by which MO25 isoforms regulates the activity of STE20 family protein kinases.
22179124 Authors conclude that miR-451 represses glioma in vitro and in vivo, likely through targeting CAB39 directly and inhibiting the PI3K/AKT pathway indirectly.
21423148 MO25 is a master regulator of SPAK/OSR1 and MST3/MST4/YSK1 protein kinases.
19892943 study describes structure of the core heterotrimeric LKB1-STRADalpha-MO25alpha complex, revealing an unusual allosteric mechanism of LKB1 activation; structure also reveals how mutations in Peutz-Jeghers syndrome & sporadic cancers impair LKB1 function
19513107 ATP and MO25alpha cooperate to maintain STRADalpha in an "active" closed conformation required for LKB1 activation.
19386264 These data define a brush border induction pathway downstream of the Lkb1/Strad/Mo25 polarization complex, yet separate from other polarity events.
18854318 STRADalpha.MO25alpha complexes containing LKB1 variants were equally effective at phosphorylating and activating AMPK, BRSK1, and BRSK2

AA Sequence

MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQL      1 - 70
AQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIA     71 - 140
LNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRF    141 - 210
FSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKV    211 - 280
FVANPNKTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRPAQQEA             281 - 341
//

Text Mined References (33)

PMID Year Title
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24393035 2014 The WNK-regulated SPAK/OSR1 kinases directly phosphorylate and inhibit the K+-Cl- co-transporters.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23296203 2013 Structural insights into the activation of MST3 by MO25.
22179124 2012 MicroRNA miR-451 downregulates the PI3K/AKT pathway through CAB39 in human glioma.
21423148 2011 MO25 is a master regulator of SPAK/OSR1 and MST3/MST4/YSK1 protein kinases.
More...