Property Summary

NCBI Gene PubMed Count 51
PubMed Score 14.48
PubTator Score 22.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 1.9e-06
Breast cancer 2.900 3.4e-02
Down syndrome 1.200 7.3e-04
ductal carcinoma in situ -1.100 1.0e-03
ependymoma 1.400 6.7e-13
glioblastoma 1.400 9.5e-07
invasive ductal carcinoma -1.600 1.0e-03
lung cancer -1.300 9.6e-03
malignant mesothelioma -1.700 1.2e-07
Multiple myeloma 1.276 2.2e-02
osteosarcoma 1.369 1.6e-03
ovarian cancer -2.800 4.3e-12
pediatric high grade glioma 1.700 3.7e-07
sonic hedgehog group medulloblastoma 1.100 3.7e-06
Waldenstrons macroglobulinemia 1.061 1.3e-02

Gene RIF (24)

AA Sequence

MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPN      1 - 70
PNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSA     71 - 140
LNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETRNSSEQELRITQSEFDRQAEITR    141 - 210
LLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSNYLSNNNQTSVTPVPSVLPNAIG    211 - 280
SSAMASTSGLVITSPSNLSDLKECSGSRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERG    281 - 350
NQKGKVPITYLELLN                                                           351 - 365
//

Text Mined References (55)

PMID Year Title