Property Summary

NCBI Gene PubMed Count 45
Grant Count 11
R01 Count 11
Funding $592,094.59
PubMed Score 4.54
PubTator Score 22.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.061 0.013
Multiple myeloma 1.454 0.001
malignant mesothelioma -1.700 0.000
glioblastoma 2.600 0.000
osteosarcoma 1.369 0.002
ependymoma 1.400 0.000
lung cancer -1.300 0.010
Breast cancer 2.900 0.034
pediatric high grade glioma 1.700 0.000
pilocytic astrocytoma 1.200 0.000
sonic hedgehog group medulloblastoma 1.100 0.000
ductal carcinoma in situ -1.100 0.001
invasive ductal carcinoma -1.600 0.001
ovarian cancer -2.800 0.000
Down syndrome 1.200 0.001

Gene RIF (20)

PMID Text
25981964 Our findings suggest that endophilin-B1 is a key mediator of a feed-forward mechanism of Alzheimer's disease pathogenesis
25619828 these data reveal an Irgm1-dependent mechanism that promotes the tumorigenesis of melanoma via dual regulation of apoptosis and Bif-1-dependent autophagy
23429496 Data suggest that activated autophagy is associated with the progression of pancreatic ductal adenocarcinoma and that the overexpression of autophagy-related proteins Atg5, Ambra1, beclin-1, LC3B and Bif-1 is significantly correlated with poor outcome.
22785202 these data suggest a novel function for Bif-1 as a suppressor of breast cancer cell migration by promoting EGFR degradation through the regulation of endosome maturation
21283040 The expression of Bif-1 is downregulated in a subset of pancreatic ductal adenocarcinoma. This novel finding is in agreement with the tumor suppressor function of Bif-1.
21068542 These findings suggest that Bif-1 acts as a critical regulator of Atg9 puncta formation presumably by mediating Golgi fission for autophagosome biogenesis during starvation.
20159967 GSK-3beta promotes cell survival by modulating Bif-1-dependent autophagic response and cell death.
19805544 Bax activates endophilin B1 oligomerization and lipid membrane vesiculation
19132989 Deregulation of Bif-1-related cell death is dependent not on Bif-1 mutation but on other mechanisms.
19132989 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPN      1 - 70
PNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSA     71 - 140
LNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETRNSSEQELRITQSEFDRQAEITR    141 - 210
LLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSNYLSNNNQTSVTPVPSVLPNAIG    211 - 280
SSAMASTSGLVITSPSNLSDLKECSGSRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERG    281 - 350
NQKGKVPITYLELLN                                                           351 - 365
//

Text Mined References (49)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25981964 2015 Loss of endophilin-B1 exacerbates Alzheimer's disease pathology.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25619828 2015 IFNg-induced Irgm1 promotes tumorigenesis of melanoma via dual regulation of apoptosis and Bif-1-dependent autophagy.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
24056303 2013 PtdIns(3)P-bound UVRAG coordinates Golgi-ER retrograde and Atg9 transport by differential interactions with the ER tether and the beclin 1 complex.
23429496 2013 Prognostic significance of autophagy-related protein expression in resected pancreatic ductal adenocarcinoma.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
More...