Property Summary

NCBI Gene PubMed Count 45
PubMed Score 4.54
PubTator Score 22.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ependymoma 2514 6.72462752650848E-13
ovarian cancer 8492 4.3316470350525E-12
malignant mesothelioma 3163 1.19375928408231E-7
pediatric high grade glioma 2712 3.72194277690547E-7
pilocytic astrocytoma 3086 1.20563290461859E-6
sonic hedgehog group medulloblastoma 1482 3.67098784579374E-6
glioblastoma 5572 8.17493173535629E-5
Multiple myeloma 1328 7.17297896437116E-4
Down syndrome 548 7.29334882920576E-4
ductal carcinoma in situ 1745 0.00101817481101834
invasive ductal carcinoma 2950 0.00104234531579853
osteosarcoma 7933 0.00159676890611287
lung cancer 4473 0.0095657551189899
Waldenstrons macroglobulinemia 765 0.013024440047941
Breast cancer 3099 0.0336881073761581

Expression

  Differential Expression (15)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.061 0.013
Multiple myeloma 1.454 0.001
malignant mesothelioma -1.700 0.000
glioblastoma 2.600 0.000
osteosarcoma 1.369 0.002
ependymoma 1.400 0.000
lung cancer -1.300 0.010
Breast cancer 2.900 0.034
pediatric high grade glioma 1.700 0.000
pilocytic astrocytoma 1.200 0.000
sonic hedgehog group medulloblastoma 1.100 0.000
ductal carcinoma in situ -1.100 0.001
invasive ductal carcinoma -1.600 0.001
ovarian cancer -2.800 0.000
Down syndrome 1.200 0.001

Synonym

Accession Q9Y371 B4E182 Q5H8U5 Q9H3Z0 Q9NR47 Q9NYA9
Symbols Bif-1
CGI-61
PPP1R70
dJ612B15.2

Gene

  Ortholog (11)

 MGI Term (1)

Gene RIF (20)

PMID Text
25981964 Our findings suggest that endophilin-B1 is a key mediator of a feed-forward mechanism of Alzheimer's disease pathogenesis
25619828 these data reveal an Irgm1-dependent mechanism that promotes the tumorigenesis of melanoma via dual regulation of apoptosis and Bif-1-dependent autophagy
23429496 Data suggest that activated autophagy is associated with the progression of pancreatic ductal adenocarcinoma and that the overexpression of autophagy-related proteins Atg5, Ambra1, beclin-1, LC3B and Bif-1 is significantly correlated with poor outcome.
22785202 these data suggest a novel function for Bif-1 as a suppressor of breast cancer cell migration by promoting EGFR degradation through the regulation of endosome maturation
21283040 The expression of Bif-1 is downregulated in a subset of pancreatic ductal adenocarcinoma. This novel finding is in agreement with the tumor suppressor function of Bif-1.
21068542 These findings suggest that Bif-1 acts as a critical regulator of Atg9 puncta formation presumably by mediating Golgi fission for autophagosome biogenesis during starvation.
20159967 GSK-3beta promotes cell survival by modulating Bif-1-dependent autophagic response and cell death.
19805544 Bax activates endophilin B1 oligomerization and lipid membrane vesiculation
19132989 Deregulation of Bif-1-related cell death is dependent not on Bif-1 mutation but on other mechanisms.
19132989 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPN      1 - 70
PNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSA     71 - 140
LNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETRNSSEQELRITQSEFDRQAEITR    141 - 210
LLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSNYLSNNNQTSVTPVPSVLPNAIG    211 - 280
SSAMASTSGLVITSPSNLSDLKECSGSRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERG    281 - 350
NQKGKVPITYLELLN                                                           351 - 365
//

Text Mined References (49)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25981964 2015 Loss of endophilin-B1 exacerbates Alzheimer's disease pathology.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25619828 2015 IFNg-induced Irgm1 promotes tumorigenesis of melanoma via dual regulation of apoptosis and Bif-1-dependent autophagy.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
24056303 2013 PtdIns(3)P-bound UVRAG coordinates Golgi-ER retrograde and Atg9 transport by differential interactions with the ER tether and the beclin 1 complex.
23429496 2013 Prognostic significance of autophagy-related protein expression in resected pancreatic ductal adenocarcinoma.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
More...