Property Summary

NCBI Gene PubMed Count 10
PubMed Score 12.71
PubTator Score 3.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.100 2.7e-04
lung cancer 1.100 2.8e-03
ovarian cancer 1.400 8.4e-05
posterior fossa group B ependymoma 1.100 1.3e-09

Synonym

Accession Q9Y366 B3KMA1 E1P5W9 Q5H8Z0 Q9H1G3 Q9H1G4 Q9H1H2
Symbols NGD2
NGD5
CGI-53
C20orf9

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (2)

AA Sequence

MEKELRSTILFNAYKKEIFTTNNGYKSMQKKLRSNWKIQSLKDEITSEKLNGVKLWITAGPREKFTAAEF      1 - 70
EILKKYLDTGGDVFVMLGEGGESRFDTNINFLLEEYGIMVNNDAVVRNVYHKYFHPKEALVSSGVLNREI     71 - 140
SRAAGKAVPGIIDEESSGNNAQALTFVYPFGATLSVMKPAVAVLSTGSVCFPLNRPILAFYHSKNQGGKL    141 - 210
AVLGSCHMFSDQYLDKEENSKIMDVVFQWLTTGDIHLNQIDAEDPEISDYMMLPYTATLSKRNRECLQES    211 - 280
DEIPRDFTTLFDLSIFQLDTTSFHSVIEAHEQLNVKHEPLQLIQPQFETPLPTLQPAVFPPSFRELPPPP    281 - 350
LELFDLDETFSSEKARLAQITNKCTEEDLEFYVRKCGDILGVTSKLPKDQQDAKHILEHVFFQVVEFKKL    351 - 420
NQEHDIDTSETAFQNNF                                                         421 - 437
//

Text Mined References (11)

PMID Year Title