Property Summary

NCBI Gene PubMed Count 9
Grant Count 3
Funding $60,495
PubMed Score 12.21
PubTator Score 3.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.100 0.003
group 3 medulloblastoma 1.100 0.000
posterior fossa group B ependymoma 1.100 0.000
ovarian cancer 1.400 0.000

Synonym

Accession Q9Y366 B3KMA1 E1P5W9 Q5H8Z0 Q9H1G3 Q9H1G4 Q9H1H2
Symbols NGD2
NGD5
CGI-53
C20orf9

Gene

AA Sequence

MEKELRSTILFNAYKKEIFTTNNGYKSMQKKLRSNWKIQSLKDEITSEKLNGVKLWITAGPREKFTAAEF      1 - 70
EILKKYLDTGGDVFVMLGEGGESRFDTNINFLLEEYGIMVNNDAVVRNVYHKYFHPKEALVSSGVLNREI     71 - 140
SRAAGKAVPGIIDEESSGNNAQALTFVYPFGATLSVMKPAVAVLSTGSVCFPLNRPILAFYHSKNQGGKL    141 - 210
AVLGSCHMFSDQYLDKEENSKIMDVVFQWLTTGDIHLNQIDAEDPEISDYMMLPYTATLSKRNRECLQES    211 - 280
DEIPRDFTTLFDLSIFQLDTTSFHSVIEAHEQLNVKHEPLQLIQPQFETPLPTLQPAVFPPSFRELPPPP    281 - 350
LELFDLDETFSSEKARLAQITNKCTEEDLEFYVRKCGDILGVTSKLPKDQQDAKHILEHVFFQVVEFKKL    351 - 420
NQEHDIDTSETAFQNNF                                                         421 - 437
//

Text Mined References (9)

PMID Year Title
27466190 2016 IFT52 mutations destabilize anterograde complex assembly, disrupt ciliogenesis and result in short rib polydactyly syndrome.
26880018 2016 A homozygous nonsense variant in IFT52 is associated with a human skeletal ciliopathy.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11549316 2001 A high-resolution 6.0-megabase transcript map of the type 2 diabetes susceptibility region on human chromosome 20.
11337467 2001 Identification and characterization of the potential promoter regions of 1031 kinds of human genes.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.