Property Summary

NCBI Gene PubMed Count 18
PubMed Score 8.08
PubTator Score 7.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Protein-protein Interaction (1)

Gene RIF (9)

AA Sequence

MEKLAASTEPQGPRPVLGRESVQVPDDQDFRSFRSECEAEVGWNLTYSRAGVSVWVQAVEMDRTLHKIKC      1 - 70
RMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMG     71 - 140
ADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPK    141 - 210
AMKKMYKACLKYPEWKQKHLPHFKPWLHPEQSPLPSLALSELSVQHADSLENIDESAVAESREERMGGAG    211 - 280
GEGSDDDTSLT                                                               281 - 291
//

Text Mined References (22)

PMID Year Title