Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.57
PubTator Score 0.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

AA Sequence

MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKV      1 - 70
LEQRRQGLETYLQAVILENEELPKLFLDFLNVRHLPSLPKAESCGSFDETESEESSKLSHQPVLLFLRDP     71 - 140
YVLPAASDFPNVVIEGVLHGIFYPHLQPR                                             141 - 169
//

Text Mined References (10)

PMID Year Title