Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.57
PubTator Score 0.49

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9Y343 Q6UY33
Symbols SBBI31
PRO1284

Gene

PDB

4AZ9  

AA Sequence

MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKV      1 - 70
LEQRRQGLETYLQAVILENEELPKLFLDFLNVRHLPSLPKAESCGSFDETESEESSKLSHQPVLLFLRDP     71 - 140
YVLPAASDFPNVVIEGVLHGIFYPHLQPR                                             141 - 169
//

Text Mined References (9)

PMID Year Title
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12461558 2002 Sorting out the cellular functions of sorting nexins.