Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.57
PubTator Score 0.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
group 4 medulloblastoma 1875 1.24891964685077E-4
ovarian cancer 8492 8.08124266824582E-4
medulloblastoma, large-cell 6234 0.00358712270493309
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00751175303355287
mucosa-associated lymphoid tissue lymphoma 480 0.0420558409826996

Expression

Synonym

Accession Q9Y343 Q6UY33
Symbols SBBI31
PRO1284

Gene

PDB

4AZ9  

  Ortholog (9)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Pathway (1)

AA Sequence

MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKV      1 - 70
LEQRRQGLETYLQAVILENEELPKLFLDFLNVRHLPSLPKAESCGSFDETESEESSKLSHQPVLLFLRDP     71 - 140
YVLPAASDFPNVVIEGVLHGIFYPHLQPR                                             141 - 169
//

Text Mined References (9)

PMID Year Title
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12461558 2002 Sorting out the cellular functions of sorting nexins.