Property Summary

NCBI Gene PubMed Count 10
Grant Count 8
R01 Count 4
Funding $2,015,891.58
PubMed Score 35.66
PubTator Score 7.13

Knowledge Summary

Patent (2,697)

Expression

  Differential Expression (26)

Gene RIF (1)

PMID Text
26002055 These data support a model in which PLLP functions in myelin biogenesis through organization of myelin liquid-ordered membranes in the Golgi complex.

AA Sequence

MAEFPSKVSTRTSSPAQGAEASVSALRPDLGFVRSRLGALMLLQLVLGLLVWALIADTPYHLYPAYGWVM      1 - 70
FVAVFLWLVTIVLFNLYLFQLHMKLYMVPWPLVLMIFNISATVLYITAFIACSAAVDLTSLRGTRPYNQR     71 - 140
AAASFFACLVMIAYGVSAFFSYQAWRGVGSNAATSQMAGGYA                                141 - 182
//

Text Mined References (14)

PMID Year Title
26002055 2015 The myelin proteolipid plasmolipin forms oligomers and induces liquid-ordered membranes in the Golgi complex.
25416956 2014 A proteome-scale map of the human interactome network.
23728906 2013 A genome-wide association study of sleep habits and insomnia.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...