Property Summary

NCBI Gene PubMed Count 10
PubMed Score 35.66
PubTator Score 7.13

Knowledge Summary

Patent (2,697)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 7.12255961166623E-18
lung adenocarcinoma 2714 1.29514881310016E-14
lung carcinoma 2844 5.68380167922851E-12
psoriasis 6685 3.2055106419094E-9
atypical teratoid/rhabdoid tumor 1095 9.63504916187613E-8
glioblastoma multiforme 347 1.41861263661471E-7
Breast cancer 3099 1.92119908935051E-7
malignant mesothelioma 3163 3.30770647842774E-7
ovarian cancer 8492 5.83656536375779E-6
lung cancer 4473 1.40055845631001E-5
group 4 medulloblastoma 1875 2.04241446488804E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 2.20637098024691E-5
medulloblastoma, large-cell 6234 4.47205712516167E-5
interstitial cystitis 2299 4.72892457916835E-5
pilocytic astrocytoma 3086 7.81822570708385E-5
cystic fibrosis 1670 1.63265325244126E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 9.83831346553709E-4
subependymal giant cell astrocytoma 2287 0.00367396061884053
primitive neuroectodermal tumor 3031 0.00951033966316429
Pick disease 1893 0.0103305041542168
oligodendroglioma 2849 0.0223481787793475
pediatric high grade glioma 2712 0.0227554082562311
astrocytic glioma 2241 0.0245092650438979
ependymoma 2514 0.02684941791783
active ulcerative colitis 477 0.0373988781458063
cutaneous lupus erythematosus 1056 0.0377415949403544

Expression

  Differential Expression (26)

Synonym

Accession Q9Y342 B2R9T6
Symbols PMLP
TM4SF11

Gene

PANTHER Protein Class (1)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
26002055 These data support a model in which PLLP functions in myelin biogenesis through organization of myelin liquid-ordered membranes in the Golgi complex.

AA Sequence

MAEFPSKVSTRTSSPAQGAEASVSALRPDLGFVRSRLGALMLLQLVLGLLVWALIADTPYHLYPAYGWVM      1 - 70
FVAVFLWLVTIVLFNLYLFQLHMKLYMVPWPLVLMIFNISATVLYITAFIACSAAVDLTSLRGTRPYNQR     71 - 140
AAASFFACLVMIAYGVSAFFSYQAWRGVGSNAATSQMAGGYA                                141 - 182
//

Text Mined References (14)

PMID Year Title
26002055 2015 The myelin proteolipid plasmolipin forms oligomers and induces liquid-ordered membranes in the Golgi complex.
25416956 2014 A proteome-scale map of the human interactome network.
23728906 2013 A genome-wide association study of sleep habits and insomnia.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...