Property Summary

NCBI Gene PubMed Count 10
PubMed Score 39.29
PubTator Score 7.13

Knowledge Summary

Patent (2,697)

Expression

  Differential Expression (26)

Disease log2 FC p
malignant mesothelioma -1.700 3.3e-07
active ulcerative colitis 2.181 3.7e-02
astrocytic glioma -1.400 2.4e-02
Astrocytoma, Pilocytic 1.800 1.0e-04
atypical teratoid / rhabdoid tumor -2.100 2.7e-06
Breast cancer -1.600 1.9e-07
cutaneous lupus erythematosus -1.600 3.8e-02
cystic fibrosis -1.900 1.6e-04
ependymoma -1.600 2.6e-02
glioblastoma multiforme -1.300 1.4e-07
group 3 medulloblastoma -2.300 3.8e-03
interstitial cystitis -1.700 1.4e-03
intraductal papillary-mucinous adenoma (... 2.200 2.2e-05
intraductal papillary-mucinous neoplasm ... 1.300 9.8e-04
lung adenocarcinoma -1.700 1.3e-14
lung cancer -1.600 2.2e-03
lung carcinoma -1.300 5.7e-12
medulloblastoma, large-cell -2.600 4.5e-05
non-small cell lung cancer -2.247 7.1e-18
oligodendroglioma -1.400 2.2e-02
ovarian cancer -1.500 5.8e-06
pediatric high grade glioma -1.300 2.3e-02
Pick disease -1.600 1.0e-02
primitive neuroectodermal tumor -1.800 9.5e-03
psoriasis -1.800 3.2e-09
subependymal giant cell astrocytoma -3.083 3.7e-03

Gene RIF (1)

AA Sequence

MAEFPSKVSTRTSSPAQGAEASVSALRPDLGFVRSRLGALMLLQLVLGLLVWALIADTPYHLYPAYGWVM      1 - 70
FVAVFLWLVTIVLFNLYLFQLHMKLYMVPWPLVLMIFNISATVLYITAFIACSAAVDLTSLRGTRPYNQR     71 - 140
AAASFFACLVMIAYGVSAFFSYQAWRGVGSNAATSQMAGGYA                                141 - 182
//

Text Mined References (14)

PMID Year Title