Property Summary

NCBI Gene PubMed Count 54
Grant Count 17
R01 Count 13
Funding $1,127,180.29
PubMed Score 73.36
PubTator Score 77.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.800 0.010
ependymoma -2.000 0.017
oligodendroglioma -1.900 0.009
esophageal adenocarcinoma -1.300 0.041
Atopic dermatitis -2.300 0.001
breast carcinoma -1.300 0.000
diabetes mellitus 1.400 0.001
non-inflammatory breast cancer -3.600 0.000
invasive ductal carcinoma -1.500 0.041

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
873 screening 1264 / 0 / 212997 Kallikrein 5 1536 HTS
1431 confirmatory 109 / 0 / 1151 Kallikrein 5 1536 HTS Dose Response Confirmation

Gene RIF (40)

PMID Text
26345898 the expression level of hK5 in tumor stromal cells is a promising biomarker for poor prognosis in TNBC.
26022646 This report demonstrates that concurrent loss of KLK5 and KLK7 associates with a poor clinical outcome in Oral Squamous-Cell Carcinoma and could therefore serve as prognostic marker in this disease.
24534191 KLK5 is an important contributor to the Netherton syndrome proteolytic cascade.
24158494 Low KLK5 expression is associated with breast cancer.
23629652 KLK5 is required for biochemical processing of profilaggrin in human skin.
23612974 Kallikrein 5 and kallikrein 12 cleave human influenza hemagglutinins and activate thrombolytic zymogens.
22505519 the inhibition and binding of different SPINK9 variants towards KLK5, KLK7, KLK8 and KLK14
22102857 Loss of KLK5 is associated with ovarian cancer.
21868565 Significant co-expression of KLKs 5 and 7 was observed in the same cancer samples. Increased KLK5 expression was a statistically significant independent prognostic factor for DFS and OS of patients
21741862 Data indicate that the KLK5 SNP rs268908 was associated with an increased risk of prostate cancer.
More...

AA Sequence

MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIING      1 - 70
SDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSI     71 - 140
PHPGYSHPGHSNNLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNIS    141 - 210
VLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCK    211 - 280
FTKWIQETIQANS                                                             281 - 293
//

Text Mined References (57)

PMID Year Title
26345898 2015 Human kallikrein 5 as a novel prognostic biomarker for triple-negative breast cancer: tissue expression analysis and relationship with disease course.
26022646 2015 The Co-Expression of Kallikrein 5 and Kallikrein 7 Associates with Poor Survival in Non-HPV Oral Squamous-Cell Carcinoma.
24534191 2014 Transgenic kallikrein 5 mice reproduce major cutaneous and systemic hallmarks of Netherton syndrome.
24158494 2014 The KLK5 protease suppresses breast cancer by repressing the mevalonate pathway.
23629652 2013 Kallikrein-related peptidase 5 functions in proteolytic processing of profilaggrin in cultured human keratinocytes.
23612974 2013 Cleavage activation of human-adapted influenza virus subtypes by kallikrein-related peptidases 5 and 12.
22505519 2012 Characterization of SPINK9, a KLK5-specific inhibitor expressed in palmo-plantar epidermis.
22102857 2011 Kallikreins 5, 6 and 10 differentially alter pathophysiology and overall survival in an ovarian cancer xenograft model.
21868565 2011 Evaluation of kallikrein-related peptidase 5 expression and its significance for breast cancer patients: association with kallikrein-related peptidase 7 expression.
21741862 2013 Common variation in Kallikrein genes KLK5, KLK6, KLK12, and KLK13 and risk of prostate cancer and tumor aggressiveness.
More...