Property Summary

NCBI Gene PubMed Count 31
Grant Count 37
Funding $7,462,155.17
PubMed Score 36.81
PubTator Score 39.37

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Gene RIF (23)

PMID Text
26694037 Ligands for Siglec-8 and Siglec-9 may regulate the function of eosinophils, mast cells, neutrophils, and other cells in sinus mucosa.
25747723 Inflammation results in up-regulation of immuneinhibitory Siglec-8 and Siglec-9 sialoglycan ligands on human airways.
25225409 a polymorphism that reduced Siglec-9 binding to carcinomas was associated with improved early survival in non-small-cell lung cancer patients
24882272 Dasatinib enhances migration of monocyte-derived dendritic cells by reducing phosphorylation of inhibitory immune receptors Siglec-9 and Siglec-3.
24569453 Expression of Siglec-7 and -9 ligands was associated with susceptibility of NK cell-sensitive tumor cells and, unexpectedly, of presumably NK cell-resistant tumor cells to NK cell-mediated cytotoxicity.
24145038 Protein degradation of focal adhesion kinase and related molecules was induced by Siglec-9 binding to its counterreceptors via sialylglycoconjugates, leading to the modulation of adhesion kinetics of cancer cells.
24045940 Siglec-9 expressed on immune cells may play a role as a potential counterreceptor for MUC1 and that this signaling may be another MUC1-mediated pathway and function in parallel with a growth factor-dependent pathway.
21821708 The Siglec-9 peptide binding to the enzymatic groove of VAP-1 can be used for imaging conditions, such as inflammation and cancer.
20971061 These results suggest that Siglec-9 expressed on DCs is involved in immunoregulation through ligation with mucins in an epithelial cancer patient.
20733319 Siglec-9 A391C was the only polymorphism related to TCR-mediated signaling in human Siglec-9, resulting in less inhibition compared to the wild type.
More...

AA Sequence

MLLLLLPLLWGRERAEGQTSKLLTMQSSVTVQEGLCVHVPCSFSYPSHGWIYPGPVVHGYWFREGANTDQ      1 - 70
DAPVATNNPARAVWEETRDRFHLLGDPHTKNCTLSIRDARRSDAGRYFFRMEKGSIKWNYKHHRLSVNVT     71 - 140
ALTHRPNILIPGTLESGCPQNLTCSVPWACEQGTPPMISWIGTSVSPLDPSTTRSSVLTLIPQPQDHGTS    141 - 210
LTCQVTFPGASVTTNKTVHLNVSYPPQNLTMTVFQGDGTVSTVLGNGSSLSLPEGQSLRLVCAVDAVDSN    211 - 280
PPARLSLSWRGLTLCPSQPSNPGVLELPWVHLRDAAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQGVV    281 - 350
GGAGATALVFLSFCVIFVVVRSCRKKSARPAAGVGDTGIEDANAVRGSASQGPLTEPWAEDSPPDQPPPA    351 - 420
SARSSVGEGELQYASLSFQMVKPWDSRGQEATDTEYSEIKIHR                               421 - 463
//

Text Mined References (33)

PMID Year Title
26694037 2016 Regulation of airway inflammation by Siglec-8 and Siglec-9 sialoglycan ligand expression.
25747723 2015 Expression of ligands for Siglec-8 and Siglec-9 in human airways and airway cells.
25225409 2014 Engagement of myelomonocytic Siglecs by tumor-associated ligands modulates the innate immune response to cancer.
24882272 2014 Dasatinib enhances migration of monocyte-derived dendritic cells by reducing phosphorylation of inhibitory immune receptors Siglec-9 and Siglec-3.
24569453 2014 Interactions between Siglec-7/9 receptors and ligands influence NK cell-dependent tumor immunosurveillance.
24145038 2013 Binding of a sialic acid-recognizing lectin Siglec-9 modulates adhesion dynamics of cancer cells via calpain-mediated protein degradation.
24045940 2013 Binding of the sialic acid-binding lectin, Siglec-9, to the membrane mucin, MUC1, induces recruitment of ?-catenin and subsequent cell growth.
21821708 2011 Siglec-9 is a novel leukocyte ligand for vascular adhesion protein-1 and can be used in PET imaging of inflammation and cancer.
20971061 2010 Immunomodulation of monocyte-derived dendritic cells through ligation of tumor-produced mucins to Siglec-9.
20733319 2011 A novel function of Siglec-9 A391C polymorphism on T cell receptor signaling.
More...