Property Summary

NCBI Gene PubMed Count 30
PubMed Score 21.54
PubTator Score 350.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid/rhabdoid tumor 1095 1.32288170877448E-6
group 3 medulloblastoma 2254 2.6246251496009E-4
lung cancer 4473 2.709493007134E-4
diabetes mellitus 1663 0.00118210646114099
Disease Target Count Z-score Confidence
Orchitis 16 3.133 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.800 0.000
atypical teratoid/rhabdoid tumor 1.200 0.000
lung cancer 2.100 0.000
diabetes mellitus -1.300 0.001

Synonym

Accession Q9Y333 Q6FGG1
Symbols G7B
snRNP
C6orf28
YBL026W

Gene

PDB

3JCR  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (6)

PMID Text
26261020 SNRPN is a key player in pancreatic adenocarcinoma cell growth; depletion of SNRPN led to S phase cell cycle arrest and apoptosis
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
18095154 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12515382 LSm1-7 proteins colocalize with DCP1,DCP2 and Xrn1 in cytoplasmic foci

AA Sequence

MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYV      1 - 70
QLPADEVDTQLLQDAARKEALQQKQ                                                  71 - 95
//

Text Mined References (33)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26261020 2015 Small nuclear ribonucleoprotein associated polypeptide N accelerates cell proliferation in pancreatic adenocarcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
24056301 2013 The deubiquitylase USP33 discriminates between RALB functions in autophagy and innate immune response.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...