Property Summary

NCBI Gene PubMed Count 31
PubMed Score 22.96
PubTator Score 350.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 5112 7.9e-06
group 3 medulloblastoma 4104 2.6e-04
diabetes mellitus 1728 1.2e-03
lung cancer 4740 1.6e-02
Disease Target Count Z-score Confidence
Orchitis 28 3.129 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 7.9e-06
diabetes mellitus -1.300 1.2e-03
group 3 medulloblastoma 1.800 2.6e-04
lung cancer 1.100 1.6e-02

Gene RIF (6)

AA Sequence

MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYV      1 - 70
QLPADEVDTQLLQDAARKEALQQKQ                                                  71 - 95
//

Text Mined References (34)

PMID Year Title