Property Summary

NCBI Gene PubMed Count 11
PubMed Score 12.21
PubTator Score 7.74

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count
Lupus Erythematosus, Systemic 73
Disease Target Count P-value
osteosarcoma 7933 2.35926056368097E-6
group 3 medulloblastoma 2254 4.70831984952614E-4


  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.320 0.000
group 3 medulloblastoma 1.200 0.000


Accession Q9Y330 B0UY00 Q5JQ98
Symbols G10


  Ortholog (8)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (1)

23079975 Single nucleotide polymorphisms at C6orf48, BAT2 and ZBTB12 are associated with estrogen receptor positive breast cancer in the Chinese Han population.

AA Sequence

DVRFAHKPAIRRHLKEQHGKTTAENVLEASVAEINVLIR                                   421 - 459

Text Mined References (12)

PMID Year Title
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
23263863 2013 GWAS of blood cell traits identifies novel associated loci and epistatic interactions in Caucasian and African-American children.
23079975 2012 Association of MHC class-III gene polymorphisms with ER-positive breast cancer in Chinese Han population.
22566634 2012 The genetic architecture of economic and political preferences.
21764829 2011 A genome-wide association study of hepatitis B vaccine response in an Indonesian population reveals multiple independent risk variants in the HLA region.
17693683 2007 Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14656967 2003 Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.