Property Summary

NCBI Gene PubMed Count 11
PubMed Score 12.05
PubTator Score 7.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 2.4e-06
group 3 medulloblastoma 4104 4.7e-04

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.200 4.7e-04
osteosarcoma 1.320 2.4e-06

Gene RIF (1)

AA Sequence

MASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVADSLKFRGHKVILAACSPFLRDQFLLNPSSEL      1 - 70
QVSLMHSARIVADLLLSCYTGALEFAVRDIVNYLTAASYLQMEHVVEKCRNALSQFIEPKIGLKEDGVSE     71 - 140
ASLVSSISATKSLLPPARTPKPAPKPPPPPPLPPPLLRPVKLEFPLDEDLELKAEEEDEDEDEDVSDICI    141 - 210
VKVESALEVAHRLKPPGGLGGGLGIGGSVGGHLGELAQSSVPPSTVAPPQGVVKACYSLSEDAEGEGLLL    211 - 280
IPGGRASVGATSGLVEAAAVAMAARGAGGSLGAGGSRGPLPGGFSGGNPLKNIKCTKCPEVFQGVEKLVF    281 - 350
HMRAQHFIFMCPRCGKQFNHSSNLNRHMNVHRGVKSHSCGICGKCFTQKSTLHDHLNLHSGARPYRCSYC    351 - 420
DVRFAHKPAIRRHLKEQHGKTTAENVLEASVAEINVLIR                                   421 - 459
//

Text Mined References (12)

PMID Year Title