Property Summary

NCBI Gene PubMed Count 10
PubMed Score 96.26
PubTator Score 15.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
active Crohn's disease 1.003 7.9e-03
acute quadriplegic myopathy 1.023 2.3e-06
adult high grade glioma 1.200 9.1e-03
Astrocytoma, Pilocytic 1.300 9.3e-05
ependymoma 1.100 2.1e-05
glioblastoma 1.100 2.7e-05
group 3 medulloblastoma 1.300 1.2e-03
osteosarcoma -1.069 5.5e-03

 GO Function (1)

Gene RIF (1)

AA Sequence

MGKQKKTRKYATMKRMLSLRDQRLKEKDRLKPKKKEKKDPSALKEREVPQHPSCLFFQYNTQLGPPYHIL      1 - 70
VDTNFINFSIKAKLDLVQSMMDCLYAKCIPCITDCVMAEIEKLGQKYRVALRIAKDPRFERLPCTHKGTY     71 - 140
ADDCLVQRVTQHKCYIVATVDRDLKRRIRKIPGVPIMYISNHRYNIERMPDDYGAPRF                141 - 198
//

Text Mined References (10)

PMID Year Title