Property Summary

NCBI Gene PubMed Count 10
Grant Count 25
R01 Count 11
Funding $1,869,775.85
PubMed Score 88.07
PubTator Score 15.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 2.397 0.000
posterior fossa group B ependymoma 1.400 0.000
glioblastoma 1.100 0.000
acute quadriplegic myopathy 1.023 0.000
active Crohn's disease 1.003 0.008
pediatric high grade glioma 1.400 0.000
group 3 medulloblastoma 1.300 0.001
pilocytic astrocytoma 1.300 0.000

 GO Function (1)

Gene RIF (1)

PMID Text
26237581 hUTP24 inactivation leads to aberrant processing of 18S rRNA 2 nucleotides downstream of the normal A1 cleavage site.

AA Sequence

MGKQKKTRKYATMKRMLSLRDQRLKEKDRLKPKKKEKKDPSALKEREVPQHPSCLFFQYNTQLGPPYHIL      1 - 70
VDTNFINFSIKAKLDLVQSMMDCLYAKCIPCITDCVMAEIEKLGQKYRVALRIAKDPRFERLPCTHKGTY     71 - 140
ADDCLVQRVTQHKCYIVATVDRDLKRRIRKIPGVPIMYISNHRYNIERMPDDYGAPRF                141 - 198
//

Text Mined References (10)

PMID Year Title
26237581 2015 hUTP24 is essential for processing of the human rRNA precursor at site A1, but not at site A0.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
16762320 2006 Fcf1p and Fcf2p are novel nucleolar Saccharomyces cerevisiae proteins involved in pre-rRNA processing.
15635413 2005 Nucleolar proteome dynamics.
15198809 2004 SMART amplification combined with cDNA size fractionation in order to obtain large full-length clones.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.